Active Recombinant Human FLT1, Fc-tagged
Cat.No. : | FLT1-616H |
Product Overview : | The recombinant human FLT1-Fc fusion is expressed as a 859 amino acid protein consisting of Ser27 - Arg656 region of FLT1 (Uniprot accession # P17948 - isoform 2 or soluble FLT1) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 27-656 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
Bio-activity : | Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC) |
Molecular Mass : | Calculated molecular mass (kDa): 96.9; Estimated by SDS-PAGE under reducing condition (kDa): 110-120 |
AA Sequence : | SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPL DTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTL VLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSV NTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVT EEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWH PCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGT VGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSI TLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | FLT1 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) [ Homo sapiens ] |
Official Symbol | FLT1 |
Synonyms | FLT1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FLT; vascular endothelial growth factor receptor 1; VEGFR1; FLT-1; VEGFR-1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor; |
Gene ID | 2321 |
mRNA Refseq | NM_001159920 |
Protein Refseq | NP_001153392 |
MIM | 165070 |
UniProt ID | P17948 |
Chromosome Location | 13q12 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | ATP binding; growth factor binding; nucleotide binding; protein binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity; vascular endothelial growth factor-activated receptor activity; |
◆ Recombinant Proteins | ||
FLT1-474H | Recombinant Human FLT1 Protein, His-tagged | +Inquiry |
Flt1-8712RAF555 | Recombinant Rat Flt1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
FLT1-2020R | Recombinant Rat FLT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FLT1-938H | Recombinant Human FLT1 Protein, DDK-tagged | +Inquiry |
FLT1-923H | Recombinant Human FLT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT1-1909HCL | Recombinant Human FLT1 cell lysate | +Inquiry |
FLT1-1207RCL | Recombinant Rat FLT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT1 Products
Required fields are marked with *
My Review for All FLT1 Products
Required fields are marked with *
0
Inquiry Basket