| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Fc |
| Protein Length : |
27-328aa |
| Description : |
This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia. |
| Form : |
Liquid |
| Bio-activity : |
Measured by its ability to inhibit proliferation using HUVEC human umbilical vein endothelial cells in the presence of Human VEGF165. The ED50 range ≤ 60 ng/mL. |
| Molecular Mass : |
60.3 kDa (535aa) |
| AA Sequence : |
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Notes : |
Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |