| Species : |
Human |
| Source : |
E.coli |
| Description : |
Follistatin is an autocrine, activin-binding protein that is ubiquitously expressed with highest expression levels being in the ovary and skin. Follistatin negatively regulates the signaling of transforming growth factor beta (TGF-β) family members, such as activin, bone morphogenetic proteins (BMPs), myostatin, growth differentiation factor 11 (GDF-11), and TGF-β1. Follistatin functions as an antagonist by binding TGF-β family members to block interaction with their signaling receptors. Follistatin also inhibits the secretion of follicle-stimulating hormone (FSH) from the anterior pituitary. |
| Bio-activity : |
Neutralization of Human Activin A induced cytotoxicity of MPC-11 cells, ≤200 ng/mL; ≥5.0 x 10^3 units/mg |
| Molecular Mass : |
Monomer, 31.7 kDa (289 aa) |
| AA Sequence : |
MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |
| Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
| Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : |
Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
| Reconstitution : |
Sterile water at 0.1 mg/mL |
| Shipping : |
Room temperature |
| Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
