Recombinant Human FST Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FST-581H |
Product Overview : | FST MS Standard C13 and N15-labeled recombinant protein (NP_006341) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FST follistatin [ Homo sapiens (human) ] |
Official Symbol | FST |
Synonyms | FST; follistatin; FS; activin-binding protein; follistatin isoform FST317; |
Gene ID | 10468 |
mRNA Refseq | NM_006350 |
Protein Refseq | NP_006341 |
MIM | 136470 |
UniProt ID | P19883 |
◆ Recombinant Proteins | ||
FST-1551H | Recombinant human FST, Active | +Inquiry |
Fst-6938M | Active Recombinant Mouse Fst protein, His-tagged | +Inquiry |
FST-01H | Recombinant Human FST Protein, His-Tagged | +Inquiry |
FST-3848H | Recombinant Human FST protein(Met1-Trp344), hFc-tagged | +Inquiry |
FST-152H | Active Recombinant Human FST, His-tagged | +Inquiry |
◆ Native Proteins | ||
FST-001H | Recombinant Human FST Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
FST-1771MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-001MCL | Recombinant Mouse FST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FST Products
Required fields are marked with *
My Review for All FST Products
Required fields are marked with *