Active Recombinant Human GH1 Protein

Cat.No. : GH1-277G
Product Overview : Recombinant Human GH1 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in secretary granules. The pulsatile release of GH into circulation is regulated by the concerted actions of the hypothalamic hormones-GH-releasing hormone (GHRH) and somatostatin (SST) - as well as by signals from the periphery - ghrelin and leptin. The human GH cDNA encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. By alternative splicing, at least four isoforms of GH have been identified.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL, measured in a cell proliferation assay using Nb2-11 cells, corresponding to a specific activity of >2 6 units/mg
Molecular Mass : 20-24 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Growth Hormone (GH) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhGH should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name GH1 growth hormone 1 [ Homo sapiens ]
Official Symbol GH1
Synonyms GH1; growth hormone 1; somatotropin; GH; GH N; GHN; hGH N; pituitary growth hormone; GH-N; hGH-N; IGHD1B;
Gene ID 2688
mRNA Refseq NM_000515
Protein Refseq NP_000506
MIM 139250
UniProt ID P01241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GH1 Products

Required fields are marked with *

My Review for All GH1 Products

Required fields are marked with *

0
cart-icon