Active Recombinant Human GZMB Protein (19-247aa), C-His tagged

Cat.No. : GZMB-33H
Product Overview : Recombinant human GZMB (19-247aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability August 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 19-247 aa
Description : This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.
Form : Liquid
Bio-activity : > 7, 000 pmol/min/μg, and is defined as the amount of enzyme that cleave 1pmole of Boc-Ala-Ala-Asp-SBzl at 37 centigrade.
Molecular Mass : 26.5 kDa (235 aa)
AA Sequence : GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY< HHHHHH>
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 20 % glycerol, 1mM DTT.
Gene Name GZMB granzyme B [ Homo sapiens (human) ]
Official Symbol GZMB
Synonyms GZMB; granzyme B; C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; granzyme B; T-cell serine protease 1-3E; cathepsin G-like 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic serine protease B; fragmentin 2; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); human lymphocyte protein; EC 3.4.21.79
Gene ID 3002
mRNA Refseq NM_004131
Protein Refseq NP_004122
MIM 123910
UniProt ID P10144

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GZMB Products

Required fields are marked with *

My Review for All GZMB Products

Required fields are marked with *

0
cart-icon