Active Recombinant Human GZMB Protein (19-247aa), C-His tagged
Cat.No. : | GZMB-33H |
Product Overview : | Recombinant human GZMB (19-247aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-247 aa |
Description : | This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis. |
Form : | Liquid |
Bio-activity : | > 7, 000 pmol/min/μg, and is defined as the amount of enzyme that cleave 1pmole of Boc-Ala-Ala-Asp-SBzl at 37 centigrade. |
Molecular Mass : | 26.5 kDa (235 aa) |
AA Sequence : | GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY< HHHHHH> |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Applications : | SDS-PAGE, Enzyme Activity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 20 % glycerol, 1mM DTT. |
Gene Name | GZMB granzyme B [ Homo sapiens (human) ] |
Official Symbol | GZMB |
Synonyms | GZMB; granzyme B; C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; granzyme B; T-cell serine protease 1-3E; cathepsin G-like 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic serine protease B; fragmentin 2; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); human lymphocyte protein; EC 3.4.21.79 |
Gene ID | 3002 |
mRNA Refseq | NM_004131 |
Protein Refseq | NP_004122 |
MIM | 123910 |
UniProt ID | P10144 |
◆ Recombinant Proteins | ||
Gzmb-5682M | Recombinant Mouse Gzmb Protein (Gly19-Ser247), C-His tagged | +Inquiry |
GZMB-35R | Recombinant Rat GZMB Protein, His-tagged | +Inquiry |
Gzmb-1966M | Active Recombinant Mouse Granzyme B, His-tagged | +Inquiry |
Gzmb-2516M | Recombinant Mouse Gzmb Protein | +Inquiry |
GZMB-7411M | Recombinant Mouse GZMB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMB-2944HCL | Recombinant Human GZMB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMB Products
Required fields are marked with *
My Review for All GZMB Products
Required fields are marked with *