Active Recombinant Human HGF Protein

Cat.No. : HGF-01H
Product Overview : Recombinant Human HGF without tag, sourced from HEK293 cells, is a polypeptide consisting of 695 amino acid residues.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss.
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of monkey 4MBr-5 cells.
Molecular Mass : 79.4 kDa
AA Sequence : Alpha chain:KRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR
Beta chain:VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Purity : ≥ 95% by SDS-PAGE gel and HPLC analyses.
Gene Name HGF hepatocyte growth factor [ Homo sapiens (human) ]
Official Symbol HGF
Synonyms HGF; hepatocyte growth factor; SF; HGFB; HPTA; F-TCF; DFNB39; hepatocyte growth factor; fibroblast-derived tumor cytotoxic factor; hepatocyte growth factor (hepapoietin A; scatter factor); hepatopoietin-A; lung fibroblast-derived mitogen
Gene ID 3082
mRNA Refseq NM_000601
Protein Refseq NP_000592
MIM 142409
UniProt ID P14210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HGF Products

Required fields are marked with *

My Review for All HGF Products

Required fields are marked with *

0
cart-icon