Active Recombinant Human HGF Protein
Cat.No. : | HGF-01H |
Product Overview : | Recombinant Human HGF without tag, sourced from HEK293 cells, is a polypeptide consisting of 695 amino acid residues. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of monkey 4MBr-5 cells. |
Molecular Mass : | 79.4 kDa |
AA Sequence : | Alpha chain:KRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR Beta chain:VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
Purity : | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
Gene Name | HGF hepatocyte growth factor [ Homo sapiens (human) ] |
Official Symbol | HGF |
Synonyms | HGF; hepatocyte growth factor; SF; HGFB; HPTA; F-TCF; DFNB39; hepatocyte growth factor; fibroblast-derived tumor cytotoxic factor; hepatocyte growth factor (hepapoietin A; scatter factor); hepatopoietin-A; lung fibroblast-derived mitogen |
Gene ID | 3082 |
mRNA Refseq | NM_000601 |
Protein Refseq | NP_000592 |
MIM | 142409 |
UniProt ID | P14210 |
◆ Recombinant Proteins | ||
Hgf-8664MAF555 | Recombinant Mouse Hgf Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
HGF-592H | Recombinant Human Hepatocyte Growth Factor (Hepapoietin A; Scatter Factor) | +Inquiry |
HGF-4235H | Recombinant Human HGF Protein (Gln31-Ser723), C-His tagged | +Inquiry |
Hgf-8665M | Recombinant Mouse Hgf protein(Met1-Leu728) | +Inquiry |
HGF-114H | Recombinant Active Human HGF Protein, Tag Free | +Inquiry |
◆ Native Proteins | ||
HGF-29231TH | Native Human HGF | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *
0
Inquiry Basket