Active Recombinant Human HTRA4 protein, His-tagged
Cat.No. : | HTRA4-790H |
Product Overview : | Recombinant human HTRA4 protein fragment (138 to 476 aa) was expressed in E. coli with C-terminus his tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 138-476 a.a. |
Description : | This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging. |
Form : | 0.64% Tris HCl, 15% Glycerol, 0.704% Sodium chloride, 0.816% Imidazole, pH 7.5. |
Bio-activity : | Proteolytic activity of this product was documented by digestion of ß- casein. 0.5 mg ß-casein/ml are completely digested by 10 µg/ml HTRA4 within 24 hours at 37 centigrade. |
Molecular Mass : | 38 kDa |
AA Sequence : | MRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETINHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store at -80 centigrade. Avoid freeze-thaw cycles. |
Concentration : | 0.1 mg/mL |
Gene Name | HtrA serine peptidase 4 [ Homo sapiens ] |
Official Symbol | HTRA4 |
Synonyms | HTRA4; HtrA serine peptidase 4; probable serine protease HTRA4; FLJ90724 |
Gene ID | 203100 |
mRNA Refseq | NM_153692 |
Protein Refseq | NP_710159 |
MIM | 610700 |
UniProt ID | P83105 |
◆ Recombinant Proteins | ||
HTRA4-23H | Recombinant Human HTRA4 Protein, His-tagged | +Inquiry |
HTRA4-2629R | Recombinant Rat HTRA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTRA4-4384M | Recombinant Mouse HTRA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTRA4-48H | Recombinant Human HTRA4, His-tagged | +Inquiry |
HTRA4-7945M | Recombinant Mouse HTRA4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTRA4-5328HCL | Recombinant Human HTRA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTRA4 Products
Required fields are marked with *
My Review for All HTRA4 Products
Required fields are marked with *
0
Inquiry Basket