Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
138-476 a.a. |
Description : |
This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging. |
Form : |
0.64% Tris HCl, 15% Glycerol, 0.704% Sodium chloride, 0.816% Imidazole, pH 7.5. |
Bio-activity : |
Proteolytic activity of this product was documented by digestion of ß- casein. 0.5 mg ß-casein/ml are completely digested by 10 µg/ml HTRA4 within 24 hours at 37 centigrade. |
Molecular Mass : |
38 kDa |
AA Sequence : |
MRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETINHHHHHH |
Purity : |
>90% by SDS-PAGE |
Storage : |
Store at -80 centigrade. Avoid freeze-thaw cycles. |
Concentration : |
0.1 mg/mL |