Active Recombinant Human ICAM1 Protein (28-480aa), C-hIgG-His-tagged

Cat.No. : ICAM1-14H
Product Overview : Recombinant human ICAM-1/CD54 (28-480aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 28-480 aa
Description : ICAM-1/CD54, also known as intercellular adhesion molecule 1, is a member of the immunoglobulin superfamily. It expression is weak on leukocytes, epithelial and resting endothelial cells, as well as some other cell types, but expression can be stimulated by IFNG, TNFa, IL-1b and LPS. They are important in inflammation, immune responses and in intracellular signalling events. It is known to bind to leucocyte integrins CD11/CD18 such as LFA-1 and Macrophage-1 antigen, during inflammation and in immune responses. It has been implicated in subarachnoid hemorrhage and expressed by respiratory epithelial cells is also the binding site for rhinovirus, the causative agent of most common colds.
Form : Liquid
Bio-activity : Measured by the ability of the immobilized protein to support the adhesion of HL-60 human promyelocytic cells. When cells are added to Human ICAM-1/CD54 coated plates, the ED50 range ≤ 2 μg/mL.
Molecular Mass : 76.5 kDa (692 aa)
AA Sequence : QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYE
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name ICAM1 intercellular adhesion molecule 1 [ Homo sapiens (human) ]
Official Symbol ICAM1
Synonyms ICAM1; intercellular adhesion molecule 1; BB2; CD54; human rhinovirus receptor; ICAM-1; cell surface glycoprotein P3.58; major group rhinovirus receptor; intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; P3.58
Gene ID 3383
mRNA Refseq NM_000201
Protein Refseq NP_000192
MIM 147840
UniProt ID P05362

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ICAM1 Products

Required fields are marked with *

My Review for All ICAM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon