Active Recombinant Human IFNA2A Protein (165 aa)

• Cat.No.: IFNA2-382I
• Product Overview: Recombinant Interferon-Alpha 2a (IFN-Alpha 2a), Human produced in E. coli is a single non-glycosylated polypeptide chain containing 165 amino acids. A fully biologically active molecule, rhIFN-Alpha has a molecular mass of 19.2kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 165
• Description: Interferon-Alpha 2a (IFN-Alpha 2a), Human produced by leukocytes is a member of Interferon family. IFN-alpha is mainly involved in innate immune response against a broad range of viral infections. IFN-alpha 2 has three acid stable forms (a,b,c) signaling through IFNAR2. IFN-alpha 2a shares 99.4%, 98.8% aa sequence identity with IFN-alpha 2b and 2c respectively. IFN-alpha contains four highly conserved cysteine residues which form two disulfide bonds, one of which is necessary for biological activity.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 ng/mL, measured by a cytotoxicity assay using TF-1 Cells, corresponding to a specific activity of > 1.0 × 10^7 units/mg.
• Molecular Mass: 19.2kDa, observed by reducing SDS-PAGE.
• AA Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Interferon-Alpha 2a (rhIFN-Alpha 2a) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIFN-Alpha 2a should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IFNA2 interferon alpha 2 [ Homo sapiens (human) ]
• Official Symbol: IFNA2
• Synonyms: IFNA2; interferon alpha 2; IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2; interferon alpha-2alpha-2a interferoninterferon alpha 2ainterferon alpha 2binterferon alpha A
• Gene ID: 3440
• mRNA Refseq: NM_000605
• Protein Refseq: NP_000596
• MIM: 147562
• UniProt ID: P01563