Active Recombinant Human IFNG Protein
| Cat.No. : | IFNG-115H |
| Product Overview : | Recombinant Human IFNG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Interferon gamma (IFN-γ) is a type II interferon that is critical during adaptive and innate immune responses to infection. IFN-γ is produced by T cells and natural killer cells following antigen-specific activation. IFN-γ binds IFN-γ receptors (IFN-γ R1 and IFN-γ R2), which are expressed on most immune cells, to activate the JAK-STAT pathway. IFN-γ-induced signaling increases the expression of class 1 major histocompatibility complex (MHC) molecules. Human IFN-γ is not cross-reactive with mouse IFN-γ. |
| Bio-activity : | Activity of HEK-Blue™ IFN-γ Cells, ≤0.7 ng/mL; ≥1.4 x 10^6 units/mg |
| Molecular Mass : | Monomer, 16.9 kDa (144 aa) |
| AA Sequence : | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | IFNG interferon, gamma [ Homo sapiens (human) ] |
| Official Symbol | IFNG |
| Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
| Gene ID | 3458 |
| mRNA Refseq | NM_000619 |
| Protein Refseq | NP_000610 |
| MIM | 147570 |
| UniProt ID | P01579 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *



