Active Recombinant Human IGF1 Protein (71 aa)
Cat.No. : | IGF1-377I |
Product Overview : | Recombinant Human IGF-I(N-Met) produced in E. coli is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rhIGF-I (N-Met) has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 71 |
Description : | Insulin-like growth factor I (IGF-I) also known as Somatamedin C is a hormone similar in molecular structure to insulin. Human IGF-I has two isoforms (IGF-IA and IGF-IB) which are differentially expressed by various tissues. Mature human IGF-I shares 94% and 96% aa sequence identity with mouse and rat IGF-I, respectively. Both IGF-I and IGF-II (another ligand of IGF) can signal through the IGF-I receptor (IGFIR), but only IGF-II can bind the IGF-II receptor (IGFIIR/Mannose-6-phosphate receptor). IGF-I plays an important role in childhood growth and continues to have anabolic effects in adults. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2.0 × 10^5 units/mg. |
Molecular Mass : | 7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human IGF-I(N-Met) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IGF-I should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I; |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
IGF1-4121H | Recombinant Human IGF1 protein, GST-tagged | +Inquiry |
IGF1-55H | Active Recombinant Human IGF1 protein (Gly49-Ala118(Glu 51 Arg)) | +Inquiry |
IGF1-026E | Active Recombinant Human IGF1 (26-95aa) | +Inquiry |
Igf1-1654M | Recombinant Mouse Igf1 Protein, His-tagged | +Inquiry |
IGF1-0242H | Active Recombinant Human IGF1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *