Active Recombinant Human IGF1 Protein (71 aa)

Cat.No. : IGF1-377I
Product Overview : Recombinant Human IGF-I(N-Met) produced in E. coli is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rhIGF-I (N-Met) has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 71
Description : Insulin-like growth factor I (IGF-I) also known as Somatamedin C is a hormone similar in molecular structure to insulin. Human IGF-I has two isoforms (IGF-IA and IGF-IB) which are differentially expressed by various tissues. Mature human IGF-I shares 94% and 96% aa sequence identity with mouse and rat IGF-I, respectively. Both IGF-I and IGF-II (another ligand of IGF) can signal through the IGF-I receptor (IGFIR), but only IGF-II can bind the IGF-II receptor (IGFIIR/Mannose-6-phosphate receptor). IGF-I plays an important role in childhood growth and continues to have anabolic effects in adults.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2.0 × 10^5 units/mg.
Molecular Mass : 7.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human IGF-I(N-Met) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IGF-I should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
Official Symbol IGF1
Synonyms IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID 3479
mRNA Refseq NM_000618
Protein Refseq NP_000609
MIM 147440
UniProt ID P05019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon