Active Recombinant Human IHH Protein (178 aa)
Cat.No. : | IHH-372I |
Product Overview : | Recombinant Human Indian Hedgehog (IHH) produced in E. coli is a single non-glycosylated polypeptide chain containing 178 amino acids. A fully biologically active molecule, rhIHH has a molecular mass of 20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 178 |
Description : | The Indian Hedgehog protein (IHH) is one of three proteins in the mammalian hedgehog family, the others being desert hedgehog (DHH) and Sonic hedgehog (SHH). Hedgehog proteins are important signaling molecules during embryonic development and are highly conserved across species. Mouse and human IHH share 100% amino acid identity in the signaling domain, while mouse IHH and SHH share 90% amino acid identity in the N-terminal signaling domain. IHH mRNA expression is detected in fetal lung, gut, stomach, liver, kidney, pancreas and strongly in cartilage in growth regions of the developing bone. IHH has a specific role in bone growth and differentiation. In addition, IHH is involved in yolk sac vasculogenesis, having a central role in differentiation of epiblast cells into endothelial and red blood cells. IHH gene mutations cause the brachydactyly type A1 which is characterized by shortening or malformation of the phalanges and also the acrocapitofemoral dysplasia. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 3 μg/mL, measure d by its ability to induce alkaline phosphatase production by CCL-226 cells. |
Molecular Mass : | 20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Indian Hedgehog (IHH), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human IHH should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IHH Indian hedgehog [ Homo sapiens ] |
Official Symbol | IHH |
Synonyms | IHH; Indian hedgehog; Indian hedgehog (Drosophila) homolog, Indian hedgehog homolog (Drosophila); indian hedgehog protein; BDA1; HHG2; HHG-2; Indian hedgehog homolog; |
Gene ID | 3549 |
mRNA Refseq | NM_002181 |
Protein Refseq | NP_002172 |
MIM | 600726 |
UniProt ID | Q14623 |
◆ Recombinant Proteins | ||
IHH-125H | Recombinant Human/Mouse IHH Protein | +Inquiry |
IHH-4428H | Recombinant Human IHH protein, His-tagged | +Inquiry |
Ihh-1892M | Active Recombinant Mouse Indian Hedgehog | +Inquiry |
IHH-656H | Recombinant Human IHH protein | +Inquiry |
IHH-372I | Active Recombinant Human IHH Protein (178 aa) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IHH Products
Required fields are marked with *
My Review for All IHH Products
Required fields are marked with *
0
Inquiry Basket