Active Recombinant Human IL17F Protein (133 aa)
Cat.No. : | IL17F-099I |
Product Overview : | Recombinant Human IL17F Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 133 |
Description : | Human IL-17F is synthesized as a 153 aa precursor with a 20 aa signal sequence and a 133 aa mature region. Like IL-17A, IL-17F contains one potential site for N-linked glycosylation. IL-17A and IL-17F share 50% aa sequence identity. IL17-F homodimer is produced by an activated subset of CD4+ T cells, termed Th17. IL17-F has been shown to stimulate proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to induce IL-6 production by NHDF cells, it’s fully biologically active when compared to standard. |
Molecular Mass : | A disulfide-linked homodimer of 30.1kDa, consisting of two 133 amino acid polypeptide chains. |
AA Sequence : | MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
Endotoxin : | Less than 1 EU/μg of rHuIL-17F as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL17F interleukin 17F [ Homo sapiens ] |
Official Symbol | IL17F |
Synonyms | IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F; |
Gene ID | 112744 |
mRNA Refseq | NM_052872 |
Protein Refseq | NP_443104 |
MIM | 606496 |
UniProt ID | Q96PD4 |
◆ Recombinant Proteins | ||
IL17F-114H | Active Recombinant Human Interleukin 17F | +Inquiry |
IL17F-1139H | Recombinant Human IL17F protein(31-163aa), His-GST&Myc-tagged | +Inquiry |
Il17f-964M | Active Recombinant Mouse Il17f protein(Met1-Ala161), His-tagged | +Inquiry |
IL17F-0298C | Recombinant Cynomolgus IL17F protein, His-tagged | +Inquiry |
IL17F-4333R | Recombinant Rabbit IL17F Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *
0
Inquiry Basket