Species : |
Human |
Source : |
E.coli |
Protein Length : |
133 |
Description : |
Human IL-17F is synthesized as a 153 aa precursor with a 20 aa signal sequence and a 133 aa mature region. Like IL-17A, IL-17F contains one potential site for N-linked glycosylation. IL-17A and IL-17F share 50% aa sequence identity. IL17-F homodimer is produced by an activated subset of CD4+ T cells, termed Th17. IL17-F has been shown to stimulate proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Measured by its ability to induce IL-6 production by NHDF cells, it’s fully biologically active when compared to standard. |
Molecular Mass : |
A disulfide-linked homodimer of 30.1kDa, consisting of two 133 amino acid polypeptide chains. |
AA Sequence : |
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
Endotoxin : |
Less than 1 EU/μg of rHuIL-17F as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |