Active Recombinant Human IL17RB Protein, hIgG/His-tagged

• Cat.No.: IL17RB-01H
• Product Overview: Recombinant human IL-17RB (18-292aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 18-292 a.a.
• Description: The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human IL25. The ED50 range ≤ 2 μg/mL.
• Molecular Mass: 57.3 kDa (514aa), reducing conditions
• AA Sequence: REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL17RB interleukin 17 receptor B [ Homo sapiens (human) ]
• Official Symbol: IL17RB
• Synonyms: IL17RB; interleukin 17 receptor B; CRL4; EVI27; IL17BR; IL17RH1; interleukin-17 receptor B; IL-17 receptor B; IL-17 receptor homolog 1; IL-17B receptor; IL-17RB; IL-17Rh1; cytokine receptor CRL4; cytokine receptor-like 4; interleukin 17 receptor homolog 1; interleukin-17B receptor
• Gene ID: 55540
• mRNA Refseq: NM_018725
• Protein Refseq: NP_061195
• MIM: 605458
• UniProt ID: Q9NRM6