Active Recombinant Human IL17RB Protein, hIgG/His-tagged
| Cat.No. : | IL17RB-01H |
| Product Overview : | Recombinant human IL-17RB (18-292aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | Fc&His |
| Protein Length : | 18-292 a.a. |
| Description : | The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor. |
| Form : | Liquid |
| Bio-activity : | Measured by its binding ability in a functional ELISA with Human IL25. The ED50 range ≤ 2 μg/mL. |
| Molecular Mass : | 57.3 kDa (514aa), reducing conditions |
| AA Sequence : | REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLP |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 85% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by Bradford assay) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | IL17RB interleukin 17 receptor B [ Homo sapiens (human) ] |
| Official Symbol | IL17RB |
| Synonyms | IL17RB; interleukin 17 receptor B; CRL4; EVI27; IL17BR; IL17RH1; interleukin-17 receptor B; IL-17 receptor B; IL-17 receptor homolog 1; IL-17B receptor; IL-17RB; IL-17Rh1; cytokine receptor CRL4; cytokine receptor-like 4; interleukin 17 receptor homolog 1; interleukin-17B receptor |
| Gene ID | 55540 |
| mRNA Refseq | NM_018725 |
| Protein Refseq | NP_061195 |
| MIM | 605458 |
| UniProt ID | Q9NRM6 |
| ◆ Recombinant Proteins | ||
| Il17rb-7989R | Recombinant Rat Il17rb protein, His-tagged | +Inquiry |
| Il17rb-7988M | Recombinant Mouse Il17rb protein, His-tagged | +Inquiry |
| IL17RB-0193H | Recombinant Human IL17RB protein, Fc-tagged | +Inquiry |
| IL17RB-990R | Recombinant Rhesus IL17RB Protein (Met1-Gly288), HlgG1 Fc-tagged | +Inquiry |
| IL17RB-41H | Recombinant Human IL17RB, hIgG-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17RB-549HCL | Recombinant Human IL17RB cell lysate | +Inquiry |
| IL17RB-871HCL | Recombinant Human IL17RB cell lysate | +Inquiry |
| IL17RB-1115MCL | Recombinant Mouse IL17RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17RB Products
Required fields are marked with *
My Review for All IL17RB Products
Required fields are marked with *
