Active Recombinant Human IL18BP Protein
| Cat.No. : | IL18BP-252I |
| Product Overview : | Recombinant Human IL18BP Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Description : | Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 30 ng/mL, measured in a bioassay using KG-1 cells in the presence of 50 ng/mL Human IL-18. |
| Molecular Mass : | 42-44 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | IL18BP interleukin 18 binding protein [ Homo sapiens ] |
| Official Symbol | IL18BP |
| Synonyms | IL18BP; interleukin 18 binding protein; interleukin-18-binding protein; IL18BPa; MC51L 53L 54L homolog gene product; IL-18BP; tadekinig-alfa; MC51L-53L-54L homolog gene product; |
| Gene ID | 10068 |
| mRNA Refseq | NM_001039659 |
| Protein Refseq | NP_001034748 |
| MIM | 604113 |
| UniProt ID | O95998 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL18BP Products
Required fields are marked with *
My Review for All IL18BP Products
Required fields are marked with *




