Active Recombinant Human IL18BP Protein

Cat.No. : IL18BP-252I
Product Overview : Recombinant Human IL18BP Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 30 ng/mL, measured in a bioassay using KG-1 cells in the presence of 50 ng/mL Human IL-18.
Molecular Mass : 42-44 kDa, observed by reducing SDS-PAGE.
AA Sequence : TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL18BP interleukin 18 binding protein [ Homo sapiens ]
Official Symbol IL18BP
Synonyms IL18BP; interleukin 18 binding protein; interleukin-18-binding protein; IL18BPa; MC51L 53L 54L homolog gene product; IL-18BP; tadekinig-alfa; MC51L-53L-54L homolog gene product;
Gene ID 10068
mRNA Refseq NM_001039659
Protein Refseq NP_001034748
MIM 604113
UniProt ID O95998

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL18BP Products

Required fields are marked with *

My Review for All IL18BP Products

Required fields are marked with *

0
cart-icon