Active Recombinant Human IL1R1 Protein (19-328aa), C-His-tagged

Cat.No. : IL1R1-02H
Product Overview : Recombinant human IL1RL1 (19-328aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability November 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 19-328
Description : The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.
Form : Liquid
Bio-activity : Measured by its ability to inhibit proliferation using D10.G4.1 mouse helper T cells. The ED50 range ≤10 ng/mL with Human IL-33.
Molecular Mass : 36 kDa (318aa)
AA Sequence : KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL1RL1 interleukin 1 receptor like 1 [ Homo sapiens (human) ]
Official Symbol IL1RL1
Synonyms IL1RL1; interleukin 1 receptor like 1; T1; ST2; DER4; ST2L; ST2V; FIT-1; IL33R; interleukin-1 receptor-like 1; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; interleukin 1 receptor-related protein; EC 3.2.2.6
Gene ID 9173
mRNA Refseq NM_016232
Protein Refseq NP_057316
MIM 601203
UniProt ID Q01638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1R1 Products

Required fields are marked with *

My Review for All IL1R1 Products

Required fields are marked with *

0
cart-icon
0
compare icon