Active Recombinant Human IL1R1 Protein (19-328aa), C-His-tagged
Cat.No. : | IL1R1-02H |
Product Overview : | Recombinant human IL1RL1 (19-328aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-328 |
Description : | The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. |
Form : | Liquid |
Bio-activity : | Measured by its ability to inhibit proliferation using D10.G4.1 mouse helper T cells. The ED50 range ≤10 ng/mL with Human IL-33. |
Molecular Mass : | 36 kDa (318aa) |
AA Sequence : | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | IL1RL1 interleukin 1 receptor like 1 [ Homo sapiens (human) ] |
Official Symbol | IL1RL1 |
Synonyms | IL1RL1; interleukin 1 receptor like 1; T1; ST2; DER4; ST2L; ST2V; FIT-1; IL33R; interleukin-1 receptor-like 1; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; interleukin 1 receptor-related protein; EC 3.2.2.6 |
Gene ID | 9173 |
mRNA Refseq | NM_016232 |
Protein Refseq | NP_057316 |
MIM | 601203 |
UniProt ID | Q01638 |
◆ Recombinant Proteins | ||
IL1R1-7034C | Recombinant Chicken IL1R1 | +Inquiry |
IL1R1-4266H | Recombinant Human IL1R1 Protein (Met1-Thr332), C-Fc tagged | +Inquiry |
Il1r1-882R | Recombinant Rat Il1r1 protein, His-tagged | +Inquiry |
IL1R1-772H | Active Recombinant Human IL1R1, His tagged | +Inquiry |
IL1R1-251H | Recombinant Human IL1R1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1R1-1935RCL | Recombinant Rat IL1R1 cell lysate | +Inquiry |
IL1R1-945CCL | Recombinant Cynomolgus IL1R1 cell lysate | +Inquiry |
IL1R1-1120HCL | Recombinant Human IL1R1 cell lysate | +Inquiry |
IL1R1-1787MCL | Recombinant Mouse IL1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1R1 Products
Required fields are marked with *
My Review for All IL1R1 Products
Required fields are marked with *
0
Inquiry Basket