Active Recombinant Human IL1R1 Protein (19-328aa), C-His-tagged

• Cat.No.: IL1R1-02H
• Product Overview: Recombinant human IL1RL1 (19-328aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 19-328
• Description: The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.
• Form: Liquid
• Bio-activity: Measured by its ability to inhibit proliferation using D10.G4.1 mouse helper T cells. The ED50 range ≤10 ng/mL with Human IL-33.
• Molecular Mass: 36 kDa (318aa)
• AA Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL1RL1 interleukin 1 receptor like 1 [ Homo sapiens (human) ]
• Official Symbol: IL1RL1
• Synonyms: IL1RL1; interleukin 1 receptor like 1; T1; ST2; DER4; ST2L; ST2V; FIT-1; IL33R; interleukin-1 receptor-like 1; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; interleukin 1 receptor-related protein; EC 3.2.2.6
• Gene ID: 9173
• mRNA Refseq: NM_016232
• Protein Refseq: NP_057316
• MIM: 601203
• UniProt ID: Q01638