Active Recombinant Human IL1RN Protein
Cat.No. : | IL1RN-153H |
Product Overview : | Recombinant Human IL1RN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin-1 receptor antagonist (IL-1RA) binds the interleukin 1 receptor (IL-1R) to antagonize interleukin 1 alpha and beta signaling. IL-1RA is secreted by immune cells, epithelial cells, hepatocytes, and adipocytes to inhibit IL-1-induced inflammation. IL-1RA therapy is used to treat auto-inflammatory diseases such as diabetes and rheumatoid arthritis. |
Bio-activity : | Inhibition of human IL-1 alpha induced proliferation of D10.G4.1 cells, ED50≤50 ng/mL |
Molecular Mass : | 17.3 kDa (with 153 amino acids) |
AA Sequence : | MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ] |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
Gene ID | 3557 |
mRNA Refseq | NM_000577 |
Protein Refseq | NP_000568 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
Il1rn-107R | Recombinant Rat Il1rn, His-tagged | +Inquiry |
IL1RN-188H | Active Recombinant Human IL1RN protein(Arg26-Glu177) | +Inquiry |
IL1RN-4363R | Recombinant Rabbit IL1RN Protein | +Inquiry |
Il1rn-574R | Recombinant Rat Il1rn protein | +Inquiry |
IL1RN-3569H | Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket