Active Recombinant Human IL21 protein

Cat.No. : IL21-3712H
Product Overview : Recombinant Human IL21 protein(Q9HBE4), fused with His tag, was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution in PBS, 0.02 % Tween-20, pH 7.0
Bio-activity : Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is typically 0.1-1.0 ng/mL.
Molecular Mass : Approximately 59.8 kDa on SDS-PAGE under reducing conditions, containing 531 amino acids.
AASequence : HHHHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGSGSSRGGSGSGGSGGGGSKRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Endotoxin : Less than 0.1 EU/μg of rHuIL-12, His as determined by LAL method.
Purity : > 95% by SDS-PAGE analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL21 interleukin 21 [ Homo sapiens ]
Official Symbol IL21
Synonyms IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21;
Gene ID 59067
mRNA Refseq NM_001207006
Protein Refseq NP_001193935
MIM 605384
UniProt ID Q9HBE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0
cart-icon
0
compare icon