Active Recombinant Human IL21 protein
| Cat.No. : | IL21-3712H |
| Product Overview : | Recombinant Human IL21 protein(Q9HBE4), fused with His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Form : | Lyophilized from a 0.2 μm filtered solution in PBS, 0.02 % Tween-20, pH 7.0 |
| Bio-activity : | Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is typically 0.1-1.0 ng/mL. |
| Molecular Mass : | Approximately 59.8 kDa on SDS-PAGE under reducing conditions, containing 531 amino acids. |
| AASequence : | HHHHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGSGSSRGGSGSGGSGGGGSKRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Endotoxin : | Less than 0.1 EU/μg of rHuIL-12, His as determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analyses. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | IL21 interleukin 21 [ Homo sapiens ] |
| Official Symbol | IL21 |
| Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
| Gene ID | 59067 |
| mRNA Refseq | NM_001207006 |
| Protein Refseq | NP_001193935 |
| MIM | 605384 |
| UniProt ID | Q9HBE4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *



