Active Recombinant Human IL33 Protein

Cat.No. : IL33-486H
Product Overview : Recombinant Human IL33 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : IL-33, encoded by IL-33 gene located on the Chr.9 in humans, is a 30 kDa proinflammatory protein belonging to the IL-1 superfamily and it shares less than 20 % a.a. sequence identity with other members. IL-33 secreted by high endothelial venules at high levels, which is found in tonsils, peyer patches and mesenteric lymph nodes, but not in placenta. It is upregulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL1α or IL1β stimulation. It elicits its biological effects by interacting with IL1RL1 ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3 ERK1 and or MAPK1 ERK2, MAPK14, and MAPK8. IL-33 mature protein has 52-58 % a.a. sequence identity with mouse and rat IL-33.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.05 ng/mL, corresponding to a specific activity of > 2.0×10^7 IU/mg.
Molecular Mass : Approximately 17.9 kDa
AA Sequence : SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Endotoxin : Less than 1 EU/μg of rHuIL-33 as determined by LAL method.
Purity : > 97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 150 mM NaCl, 1mM EDTA, pH7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
Gene Name IL33 interleukin 33 [ Homo sapiens (human) ]
Official Symbol IL33
Synonyms IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2;
Gene ID 90865
mRNA Refseq NM_001199640
Protein Refseq NP_001186569
MIM 608678
UniProt ID O95760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL33 Products

Required fields are marked with *

My Review for All IL33 Products

Required fields are marked with *

0
cart-icon