Active Recombinant Human IL6

Cat.No. : IL6-106H
Product Overview : Human recombinant protein expressed in Nicotiana benthamiana.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Description : This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Form : Recombinant human IL-6 is lyophilized from Tris HCl 20 mM buffer pH 8.5 and 125mM NaCl.
Bio-activity : The specific activity is determined by the dose-dependent stimulation of the proliferation of human TF-1 cells (human erytroleukemic indicator cell line). ED50 < 1 ng/ml
Molecular Mass : rhuman Interleukin-6 is a polypeptide chain containing 183 amino acids (30 – 212 of P05231 IL6_HUMAN) and 10 aa Histidine-based tag. It as a predicted molecular mass of 22.2 kDa, however as result of potential glycosilation, the recombinant protein could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel.
AA Sequence : HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity : The protein was resolved by SDS polyacrylamide gel electrophoresis and the gel was stained with coomassie blue.
Applications : Cell culture, Western Blot. Upon this protein has not been tested in a particular technique this not necessarily excludes its use in such procedures. For R+D purposes only. Purchaser must determine the suitability of the product for their particular use.
Storage : This lyophilized preparation is stable at 2-8º C for short term, long storage it should be kept at -20ºC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution : Lyophilized protein should be reconstituted in water following instructions of batch Quality Control sheet. At higher concentration the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application and cell lines.
Gene Name IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
Official Symbol IL6
Synonyms IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6;
Gene ID 3569
mRNA Refseq NM_000600
Protein Refseq NP_000591
MIM 147620
UniProt ID P05231
Chromosome Location 7p21-p15
Pathway ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem;
Function cytokine activity; cytokine activity; growth factor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; interleukin-6 receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6 Products

Required fields are marked with *

My Review for All IL6 Products

Required fields are marked with *

0
cart-icon