Active Recombinant Human IL6

Cat.No. : IL6-23H
Product Overview : Recombinant Human IL6 is a 20 to 28 kDa globular protein consisting of 212 amino acid residues.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Description : This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Form : 0.22 um filtered solution in 20 mM TRIS*HCl buffer pH 7.2
Bio-activity : ED50 < 1 ng/ml, The activity was determined by the dose dependent stimulation of the proliferation of human TF-1 cells (human erythroleukemic indicator cell line)
Molecular Mass : 21-23 kDA, glycosylated
AA Sequence : APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCF QSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLT KLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Endotoxin : < 1.0 EU per 1 μg of the protein by the LAL method.
Purity : >95%, Determined by SDS-PAGE under reducing conditions and visualized by silver stain.
Gene Name IL6 interleukin 6 [ Homo sapiens (human) ]
Official Symbol IL6
Synonyms HGF; BSF2; HSF; IFNB2; IL-6; CDF; BSF-2; B-cell stimulatory factor 2; CTL differentiation factor; Hybridoma growth factor; Interferon beta-2; Interleukin-6 precursor; interleukin 6 (interferon, beta 2); IL6
Gene ID 3569
mRNA Refseq NM_000600
Protein Refseq NP_000591
MIM 147620
UniProt ID P05231
Chromosome Location 7p21
Pathway ARMS-mediated activation; ATF-2 transcription factor network; Chagas disease (American trypanosomiasis)
Function Cytokine activity, Interleukin-6 receptor binding, Protein binding; interleukin-6 receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6 Products

Required fields are marked with *

My Review for All IL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon