Active Recombinant Human IL9 Protein
Cat.No. : | IL9-192H |
Product Overview : | Recombinant Human IL9 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 9 (IL-9) is a cytokine produced by type 2 T helper (Th2) cells and regulates hematopoietic cells. IL-9 signals through the interleukin 9 receptor (IL9R) to activate STAT signaling. IL-9 functions to induce cell proliferation, prevent cell apoptosis, and is associated with asthma and airway hyperresponsiveness. |
Bio-activity : | MO7e cell proliferation, ≤2 ng/mL |
Molecular Mass : | Monomer, 14.3 kDa (127 aa) |
AA Sequence : | MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL9 interleukin 9 [ Homo sapiens (human) ] |
Official Symbol | IL9 |
Synonyms | IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9; |
Gene ID | 3578 |
mRNA Refseq | NM_000590 |
Protein Refseq | NP_000581 |
MIM | 146931 |
UniProt ID | P15248 |
◆ Recombinant Proteins | ||
IL9-2328R | Recombinant Rhesus monkey IL9 Protein, His-tagged | +Inquiry |
IL9-4291H | Recombinant Human IL9 Protein (Met1-Ile144), C-His tagged | +Inquiry |
IL9-8181M | Recombinant Mouse IL9 Protein | +Inquiry |
Il9-477M | Active Recombinant Mouse Interleukin 9 | +Inquiry |
Il9-676R | Active Recombinant Rat Il9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *