Active Recombinant Human IL9 Protein

Cat.No. : IL9-230I
Product Overview : Recombinant Human IL9 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 1 ng/mL, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1 × 10^6 units/mg.
Molecular Mass : 25-40 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL9 interleukin 9 [ Homo sapiens ]
Official Symbol IL9
Synonyms IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9;
Gene ID 3578
mRNA Refseq NM_000590
Protein Refseq NP_000581
MIM 146931
UniProt ID P15248

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL9 Products

Required fields are marked with *

My Review for All IL9 Products

Required fields are marked with *

0
cart-icon