Active Recombinant Human Interferon Gamma Receptor 1, Fc Chimera

Cat.No. : IFNGR1-22H
Product Overview : Recombinant Human Interferon Gamma Receptor 1 encoding the signal peptide and extracellular domain of human IFN-gamma R1 (aa 1-245) chain was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Availability April 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 1-245 a.a.
Description : Interferon-gamma (IFN-gamma) is a pleotropic cytokine expressed predominantly by naïve and activated CD8+ and TH1 CD4+ T cells, and natural killer (NK) cells and, as such, promotes both innate and adaptive immune responses.The activity of IFN-gamma is mediated through its receptor, the high-affinity IFN-gamma receptor complex, a class II cytokine receptor that is present on T cells, B cells, macrophages, neutrophils and NK cells as well as non-immune somatic cells such as endothelial cells and fibroblasts.
Amino Acid Sequence : EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass : IFN-gamma R1 – Fc Chimera migrates as a broad band between 60 and 85 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI : IFN-gamma R1 – Fc Chimera separates into a number of glycoforms with a pI between 5 and 8 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate : Purified IFN-gamma R1 – Fc Chimera consists of 10-35% carbohydrate by weight.
Glycosylation : IFN-gamma R1 – Fc Chimera has N- and possibly O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50 of IFN-gamma R1 – Fc Chimera is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line.
Gene Name IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
Synonyms IFNGR1; interferon gamma receptor 1; CD119; IFNGR; FLJ45734; AVP, type 2; CD119 antigen; immune interferon receptor 1; interferon-gamma receptor alpha chain; IFN-gamma-R1; OTTHUMP00000017285; interferon gamma receptor 1
Gene ID 3459
mRNA Refseq NM_000416
Protein Refseq NP_000407
UniProt ID P15260
Chromosome Location 6q23-q24
MIM 107470
Pathway Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity
Function cytokine binding; interferon-gamma receptor activity; receptor activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNGR1 Products

Required fields are marked with *

My Review for All IFNGR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon