Active Recombinant Human Interleukin 1 Receptor Antagonist
| Cat.No. : | IL1RN-115H | 
| Product Overview : | Recombinant Humaninterleukin1 receptor antagonist (IL-1ra) protein sequence (including the signal peptide sequence, and the mature human Interleukin-1 receptor antagonist sequence) was expressed in modifiedhuman 293 cells. | 
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | Non | 
| Description : | IL-1 receptor antagonist (IL-1ra) is a naturally occurring protein that plays an important role in regulating the activity of IL-1 by competitively binding to the IL-1 receptor and thereby inhibiting IL-1 signaling activation in target cells. The expression of IL-1ra has been detected in bone marrow monocytes, macrophages, neutrophils and T cells. | 
| Amino Acid Sequence : | RPSGRKSSKM QAFRIW DVNQKT FYLRNN QLVAGY LQGPNVNLEE KIDVVPIEP ALFLGIH GGKMCLS CVKSGDET RLQLEA VNITDLSEN RKQDKRFAF IRSDSGPTT SFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE. | 
| Molecular Mass : | IL-1 receptor antagonist (IL-1ra) migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted molecular mass of 17.1 kDa. | 
| pI : | IL-1ra separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted pI of 5.4. | 
| % Carbohydrate : | Purified IL-1ra consists of 5-25% carbohydrate by weight. | 
| Glycosylation : | IL-1ra has N-linked oligosaccharides. | 
| Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. | 
| Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. | 
| Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. | 
| Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at –18 to -20°C. Repeated freeze thawing is not recommended. | 
| Activity : | The ED50of IL-1ra is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line. | 
| Gene Name | IL1RN interleukin 1 receptor antagonist [ Homo sapiens ] | 
| Synonyms | IL1RN; interleukin 1 receptor antagonist; DIRA; ICIL-1RA; IL-1ra3; IL1F3; IL1RA; IRAP; MGC10430; MVCD4; IL1RN (IL1F3); OTTHUMP00000203730; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); type II interleukin-1 receptor antagonist | 
| Gene ID | 3557 | 
| mRNA Refseq | NM_000577 | 
| Protein Refseq | NP_000568 | 
| MIM | 147679 | 
| UniProt ID | P18510 | 
| Chromosome Location | 2q14.2 | 
| Function | cytokine activity; interleukin-1 receptor antagonist activity; protein binding | 
| ◆ Recombinant Proteins | ||
| Il1rn-546M | Recombinant Mouse Il1rn protein | +Inquiry | 
| IL1RN-104I | Active Recombinant Human IL1RN Protein (153 aa) | +Inquiry | 
| Il1rn-8709R | Active Recombinant Rat Il1rn protein, hFc-tagged | +Inquiry | 
| Il1rn-168M | Recombinant Active Mouse IL1RN Protein, His-tagged(C-ter) | +Inquiry | 
| IL1RN-103I | Active Recombinant Human IL1RN Protein (153 aa) | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry | 
| IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry | 
Proinflammatory cytokines induce endocrine differentiation in pancreatic ductal cells via STAT3-dependent NGN3 activation
Journal: Cell reports PubMed ID: 27068459 Data: 2016/4/7
Authors: Ivan Achel Valdez, Ercument Dirice, Rohit N. Kulkarni
Article Snippet:TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.. Cytokine Receptor Antagonist Stimulations Human recombinant interleukin-1 receptor antagonist (Creative BioMart?, Catalog No. IL1RN-05H) concentration [50μm]; Human recombinant IFNγ receptor antagonist (Sigma-Aldrich?, Catalog No. 15152) concentration [25μM]; Human TNFα receptor antagonist (Santa CruzR, Catalog No. R-7050) concentration [25μM].. Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            