Active Recombinant Human Interleukin 1 Receptor Antagonist

Cat.No. : IL1RN-115H
Product Overview : Recombinant Humaninterleukin1 receptor antagonist (IL-1ra) protein sequence (including the signal peptide sequence, and the mature human Interleukin-1 receptor antagonist sequence) was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : IL-1 receptor antagonist (IL-1ra) is a naturally occurring protein that plays an important role in regulating the activity of IL-1 by competitively binding to the IL-1 receptor and thereby inhibiting IL-1 signaling activation in target cells. The expression of IL-1ra has been detected in bone marrow monocytes, macrophages, neutrophils and T cells.
Amino Acid Sequence : RPSGRKSSKM QAFRIW DVNQKT FYLRNN QLVAGY LQGPNVNLEE KIDVVPIEP ALFLGIH GGKMCLS CVKSGDET RLQLEA VNITDLSEN RKQDKRFAF IRSDSGPTT SFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE.
Molecular Mass : IL-1 receptor antagonist (IL-1ra) migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted molecular mass of 17.1 kDa.
pI : IL-1ra separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted pI of 5.4.
% Carbohydrate : Purified IL-1ra consists of 5-25% carbohydrate by weight.
Glycosylation : IL-1ra has N-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at –18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50of IL-1ra is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line.
Gene Name IL1RN interleukin 1 receptor antagonist [ Homo sapiens ]
Synonyms IL1RN; interleukin 1 receptor antagonist; DIRA; ICIL-1RA; IL-1ra3; IL1F3; IL1RA; IRAP; MGC10430; MVCD4; IL1RN (IL1F3); OTTHUMP00000203730; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); type II interleukin-1 receptor antagonist
Gene ID 3557
mRNA Refseq NM_000577
Protein Refseq NP_000568
MIM 147679
UniProt ID P18510
Chromosome Location 2q14.2
Function cytokine activity; interleukin-1 receptor antagonist activity; protein binding

Proinflammatory cytokines induce endocrine differentiation in pancreatic ductal cells via STAT3-dependent NGN3 activation

Journal: Cell reports    PubMed ID: 27068459    Data: 2016/4/7

Authors: Ivan Achel Valdez, Ercument Dirice, Rohit N. Kulkarni

Article Snippet:TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.. Cytokine Receptor Antagonist Stimulations Human recombinant interleukin-1 receptor antagonist (Creative BioMart?, Catalog No. IL1RN-05H) concentration [50μm]; Human recombinant IFNγ receptor antagonist (Sigma-Aldrich?, Catalog No. 15152) concentration [25μM]; Human TNFα receptor antagonist (Santa CruzR, Catalog No. R-7050) concentration [25μM].. Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0
cart-icon