Active Recombinant Human Interleukin 1 Receptor Antagonist

• Cat.No.: IL1RN-115H
• Product Overview: Recombinant Humaninterleukin1 receptor antagonist (IL-1ra) protein sequence (including the signal peptide sequence, and the mature human Interleukin-1 receptor antagonist sequence) was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: IL1RN-115H
• Description: IL-1 receptor antagonist (IL-1ra) is a naturally occurring protein that plays an important role in regulating the activity of IL-1 by competitively binding to the IL-1 receptor and thereby inhibiting IL-1 signaling activation in target cells. The expression of IL-1ra has been detected in bone marrow monocytes, macrophages, neutrophils and T cells.
• Source: Human 293 cells.
• Amino Acid Sequence: RPSGRKSSKM QAFRIW DVNQKT FYLRNN QLVAGY LQGPNVNLEE KIDVVPIEP ALFLGIH GGKMCLS CVKSGDET RLQLEA VNITDLSEN RKQDKRFAF IRSDSGPTT SFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE.
• Molecular Mass: IL-1 receptor antagonist (IL-1ra) migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted molecular mass of 17.1 kDa.
• pI: IL-1ra separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted pI of 5.4.
• % Carbohydrate: Purified IL-1ra consists of 5-25% carbohydrate by weight.
• Glycosylation: IL-1ra has N-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at –18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED₅₀of IL-1ra is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line.
• Tag: Non

Gene Information

• Gene Name: IL1RN interleukin 1 receptor antagonist [ Homo sapiens ]
• Synonyms: IL1RN; interleukin 1 receptor antagonist; DIRA; ICIL-1RA; IL-1ra3; IL1F3; IL1RA; IRAP; MGC10430; MVCD4; IL1RN (IL1F3); OTTHUMP00000203730; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); type II interleukin-1 receptor antagonist
• Gene ID: 3557
• mRNA Refseq: NM_000577
• Protein Refseq: NP_000568
• MIM: 147679
• UniProt ID: P18510
• Chromosome Location: 2q14.2
• Function: cytokine activity; interleukin-1 receptor antagonist activity; protein binding

Citation

Proinflammatory cytokines induce endocrine differentiation in pancreatic ductal cells via STAT3-dependent NGN3 activation

Journal: Cell reports    PubMed ID: 27068459    Data: 2016/4/7

Authors: Ivan Achel Valdez, Ercument Dirice, Rohit N. Kulkarni

Article Snippet:TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.TNFα [50ng/mL]; IL-1β [25ng/mL]; IFNγ [100ng/mL] corresponds to [1X] concentration.. Cytokine Receptor Antagonist Stimulations Human recombinant interleukin-1 receptor antagonist (Creative BioMart?, Catalog No. IL1RN-05H) concentration [50μm]; Human recombinant IFNγ receptor antagonist (Sigma-Aldrich?, Catalog No. 15152) concentration [25μM]; Human TNFα receptor antagonist (Santa CruzR, Catalog No. R-7050) concentration [25μM].. Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.Cells were treated with a cocktail of these cytokine receptor antagonists for 48hrs.