Active Recombinant Human Interleukin 1 Receptor Antagonist
Cat.No. : | IL1RN-115H |
Product Overview : | Recombinant Humaninterleukin1 receptor antagonist (IL-1ra) protein sequence (including the signal peptide sequence, and the mature human Interleukin-1 receptor antagonist sequence) was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Cat. No. : | IL1RN-115H |
Description : | IL-1 receptor antagonist (IL-1ra) is a naturally occurring protein that plays an important role in regulating the activity of IL-1 by competitively binding to the IL-1 receptor and thereby inhibiting IL-1 signaling activation in target cells. The expression of IL-1ra has been detected in bone marrow monocytes, macrophages, neutrophils and T cells. |
Source : | Human 293 cells. |
Amino Acid Sequence : | RPSGRKSSKM QAFRIW DVNQKT FYLRNN QLVAGY LQGPNVNLEE KIDVVPIEP ALFLGIH GGKMCLS CVKSGDET RLQLEA VNITDLSEN RKQDKRFAF IRSDSGPTT SFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE. |
Molecular Mass : | IL-1 receptor antagonist (IL-1ra) migrates as a broad band between 18 and 23 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted molecular mass of 17.1 kDa. |
pI : | IL-1ra separates into a number of isoforms with a pI between 5.4 and 6.3 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-1ra that has a predicted pI of 5.4. |
% Carbohydrate : | Purified IL-1ra consists of 5-25% carbohydrate by weight. |
Glycosylation : | IL-1ra has N-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at –18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of IL-1ra is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line. |
Gene Name : | IL1RN interleukin 1 receptor antagonist [ Homo sapiens ] |
Synonyms : | IL1RN; interleukin 1 receptor antagonist; DIRA; ICIL-1RA; IL-1ra3; IL1F3; IL1RA; IRAP; MGC10430; MVCD4; IL1RN (IL1F3); OTTHUMP00000203730; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); type II interleukin-1 receptor antagonist |
Gene ID : | 3557 |
mRNA Refseq : | NM_000577 |
Protein Refseq : | NP_000568 |
MIM : | 147679 |
UniProt ID : | P18510 |
Chromosome Location : | 2q14.2 |
Function : | cytokine activity; interleukin-1 receptor antagonist activity; protein binding |
Products Types
◆ Recombinant Protein | ||
IL1RN-164H | Active Recombinant Human IL1RN Protein (Arg26-Glu177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL1RN-167H | Recombinant Active Human IL1RN Protein, His-tagged(C-ter) | +Inquiry |
IL1RN-1171H | Recombinant Human IL1RN Protein, His (Fc)-Avi-tagged | +Inquiry |
Il1rn-1244M | Recombinant Mouse Il1rn Protein, MYC/DDK-tagged | +Inquiry |
IL1RN-055H | Recombinant Human IL1RN Protein | +Inquiry |
◆ Lysates | ||
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket