Active Recombinant Human Interleukin 6 (Interferon, Beta 2)
Cat.No. : | IL6-128H |
Product Overview : | Recombinant Human interleukin 6 (interferon, beta 2) protein sequence (containing the signal peptide sequence, and the mature human Interleukin 4 sequence) and was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
Cat. No. : | IL6-128H |
Description : | IL-6 is a pleotropic cytokine that regulates the development, proliferation and maturation of a number of hematopoietic cells and is essential for the maturation of B cells into immunoglobulin-secreting cells. |
Source : | Human 293 cells. |
Amino Acid Sequence : | APVPPGEDSKDVAA PHRQPLTSSER IDKQIRYILDG ISALRKETCN KSNMCESSK EALAENNLN LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVY LEYLQNRFE SSE EQARAV QMST KVLIQFL QKKAKN LDAITTPDPTT NASLLTKLQA QNQWLQDMT T HLI L RSFK EFLQSSLRALRQM. |
Molecular Mass : | IL-6 migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted molecular mass of 21.0kDa. |
PI : | IL-6 separates into a number of isoforms with a pI between 5.5 and 7.2 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted pI of 6.22. |
% Carbohydrate : | Purified IL-6 consists of 0-20% carbohydrate by weight. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of IL-6 is typically 0.15 - 0.35 ng/ml as measured in a cell proliferation assay using a human growth factor-dependent TF-1 cell line. |
Gene Name : | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
Synonyms : | IL6; interleukin 6 (interferon, beta 2); BSF2; HGF; HSF; IFNB2; IL-6; B cell stimulatory factor-2; B-cell differentiation factor; CTL differentiation factor; OTTHUMP00000158544; hybridoma growth factor; interleukin 6; interleukin BSF-2; (interferon, beta 2); Hybridoma growth factor |
Gene ID : | 3569 |
mRNA Refseq : | NM_000600 |
Protein Refseq : | NP_000591 |
MIM : | 147620 |
UniProt ID : | P05231 |
Chromosome Location : | 7p21 |
Pathway : | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Hematopoietic cell lineage; Graft-versus-host disease; Hypertrophic cardiomyopathy (HCM); Pathways in cancer; Prion diseases; Toll-like receptor signaling pathway |
Function : | interleukin-6 receptor activity; cytokine activity; growth factor activity |
Products Types
◆ Recombinant Protein | ||
IL6-210H | Recombinant Active Human IL6 Protein, Tag Free | +Inquiry |
IL6-1048R | Recombinant Rabbit IL6 Protein, His-tagged | +Inquiry |
IL6-02H | Active Recombinant Human IL6 Protein (30-212aa), N-His-tagged | +Inquiry |
IL6-1046H | Recombinant Horse IL6 Protein, His-tagged | +Inquiry |
IL6-1179H | Recombinant Human IL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionThe dosage and usage of Il6 will vary according to the disease, and generally require individualized regulation by the physician according to the disease situation.
The pharmacokinetic characteristics of Il6 mainly include drug absorption, distribution, metabolism, excretion and other information.
Recombinant Il6 protein has a unique therapeutic advantage in the treatment of multiple myeloma. It can promote the proliferation and differentiation of hematopoietic stem cells and inhibit the growth of tumor cells.
Il6 has specific therapeutic effects for certain diseases, such as rheumatoid arthritis, multiple myeloma and so on.
This protein is widely used in the treatment of rheumatoid arthritis, pneumonia, multiple myeloma, lymphoma, malignant tumors and other diseases.
The effects of Il6 on immune cells are mainly manifested as promoting cell proliferation and differentiation, regulating immune response, etc.
Customer Reviews (3)
Write a reviewAccurate localization and function within the cell.
The binding affinity and affinity constant with the target are high.
Can form a stable micellar structure.
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
Inquiry Basket