Active Recombinant Human Interleukin 7, His tagged, Animal Free
Cat.No. : | IL7-67H |
Product Overview : | Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). rHuman Interleukin 7 is a glycosilated polypeptide chain containing 160 amino acids (26 -177 of P13232 IL7_HUMAN ), fused to His tag at N-terminal. rHuman IL-7 migrate at approximatly 18–25 kDa by SDS-PAGE. This product contains no animal-derived components or impurities. Animal Free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Protein Length : | 26-177 a.a. |
Description : | Interleukin-7 (IL-7) is a member of the interleukin family which regulates the development and survival of lymphoid and myeloid cells. It has a potent effect for the stimulation of the adaptative immune response, it promotes proliferation of lymphoid progenitors (Pre-B, Pro-B and early T cells), and the effects include mobilization, maturation, and maintenance of IL-7 responsive immune cells.The biological functions of IL-7 as a key "lymphotrophin" in JAK-STAT pathways, PI3 kinase pathway, and Src kinase pathway. IL-7 has also been shown to play a vital role in energy metabolism of T cells and regulating glucose uptake in T lymphocytes through Glut1 via activation of STAT5 and Akt. It has a thymic antiapoptotic effect, and induce the expression of antiapoptotic proteins Bcl-2 and Mcl-1 and the inhibition of preapoptotic proteins Bax and Bad. IL-7 has potential therapeutic applications for the lymphoid reconstitution of immuno-depressed patients (chemotherapy, radiation, AIDS, and bone marrow transplant). |
Form : | Recombinant human IL-7 is lyophilized from 10mM PBS buffer pH 7.5 and 0.2 M NaCl. |
Bio-activity : | Biological Activity:The activity of recombinant Human Interleukin-7 is measured in a cell proliferation assay using PHA activated human peripheral blood lymphocytes. The ED50 for this effect is typically<10ng l="" in="" presence="" of="" goat="" anti-human="" igm="" (μ="" chain="">10ng> |
Molecular Mass : | rHuman Interleukin 7 is a glycosilated polypeptide chain containing 160 amino acids (26 -177 of P13232 IL7_HUMAN ), fused to His tag at N-terminal. rHuman IL-7 migrate at approximatly 18–25 kDa by SDS-PAGE. |
AA Sequence : | HHHHHHHHDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFL KMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLEQKKLNDLCFLKRLLQEIKTCWN KILMGTKEH |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Cell culture. Western Blot. For R+D purposes only. Purchaser must determine the suitability of the product for their particular use. |
Stability : | This lyophilized preparation is stable at 2-8oC for short term, long storage it should be kept at -20oC. |
Storage : | Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Lyophilized protein should be reconstituted in water following instructions of batch Quality Control sheet. At higher concentrations the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application. |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
Chromosome Location | 8q12-q13 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interleukin-7 signaling, organism-specific biosystem; |
Function | cytokine activity; cytokine receptor binding; growth factor activity; growth factor activity; interleukin-7 receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
Il7-174R | Recombinant Rat Interleukin 7 | +Inquiry |
IL7-9011H | Active Recombinant Human IL7 | +Inquiry |
IL7-187H | Active Recombinant Human IL7 Protein | +Inquiry |
Il7-767M | Active Recombinant Mouse Il7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket