Active Recombinant Human KDR, Fc-tagged, Biotinylated
Cat.No. : | KDR-631H |
Product Overview : | The recombinant human KDR/VEGFR2/CD309 extracellular or ecto-domain (ECD) Fc-fusion protein is expressed as a 756 amino acid protein consisting of Ala20 - Glu764 region of KDR and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 20-764 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC). |
Molecular Mass : | Calculated molecular mass (kDa): 108.9; Estimated by SDS-PAGE under reducing condition (kDa): 130-140. |
AA Sequence : | ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVI GNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEK RFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKL VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGITRSDQGLYTCAASSGLMTK KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSE RDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEE ECANEPSHAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGR GERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKL NATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEV SCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEK TNLESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ] |
Official Symbol | KDR |
Synonyms | KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor; |
Gene ID | 3791 |
mRNA Refseq | NM_002253 |
Protein Refseq | NP_002244 |
MIM | 191306 |
UniProt ID | P35968 |
Chromosome Location | 4q11-q12 |
Pathway | Angiogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; |
Function | ATP binding; Hsp90 protein binding; growth factor binding; integrin binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity; |
◆ Recombinant Proteins | ||
KDR-8718RP | Recombinant Rat KDR protein, Fc-tagged, R-PE labeled | +Inquiry |
KDR-947MAF488 | Recombinant Mouse KDR Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
KDR-947MF | Recombinant Mouse KDR Protein, His-tagged, FITC conjugated | +Inquiry |
KDR-387H | Recombinant Human KDR | +Inquiry |
Kdr-1786MA | Recombinant Mouse Kdr protein, Fc-His-tagged, APC labeled | +Inquiry |
◆ Native Proteins | ||
KDR-79H | Active Recombinant Human KDR Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
KDR-417HCL | Recombinant Human KDR cell lysate | +Inquiry |
KDR-1769HCL | Recombinant Human KDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDR Products
Required fields are marked with *
My Review for All KDR Products
Required fields are marked with *