Active Recombinant Human KITLG Protein (165 aa)
Cat.No. : | KITLG-152K |
Product Overview : | Recombinant Human KITLG Protein (165 aa) without tag was expressed in P. pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | P.pastoris |
Protein Length : | 165 |
Description : | Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50, as determined by the dose-dependent stimulation of human TF-1 cells, is < 2 ng/mL, corresponding to a specific activity of 5 × 10^5 IU/mg. |
Molecular Mass : | ~20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Stem Cell Factor (rhSCF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhSCF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 10 mM acetic acid. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69; kit ligandc-Kit ligandfamilial progressive hyperpigmentation 2mast cell growth factorsteel factorstem cell factorEC 3.2.1.31 |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
Kitlg-584R | Recombinant Rat Kitlg protein | +Inquiry |
Kitl-577M | Recombinant Mouse Kitl protein, His-tagged, Biotinylated. | +Inquiry |
KITL-526M | Recombinant Mouse KITL Protein | +Inquiry |
Kitlg-5252M | Recombinant Mouse Kit Ligand | +Inquiry |
KITLG-521H | Active Recombinant Human KITLG, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket