Active Recombinant Human KLF4 protein

Cat.No. : KLF4-72H
Product Overview : Recombinant Human KLF4 cDNA (479 aa) fused with flexible linker domain & eleven arginine (11R Tag) as membrane penetration domain at the C terminus was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Form : 0.5 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
Bio-activity : Cellular Toxicity: This recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium. Suggested reprogramming protein concentration is between 0.5 to 8 ug / ml for both human and mouse fibroblast cells applications.Biolog
AA Sequence : MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLE SGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSF TYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGL MGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQELMPPGSCM PEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH TGHRPFQCQKCDRAFSRSDHLALHMKRHFESGGGGSPGRRRRRRRRRRR
Purity : >70% by SDS-PAGE
Applications : 1. May be used for in vitro human Klf4 mediated iPS generation mechanism, or its gene specific transcription regulation study with intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for Klf4 protein-protein interaction mapping.4. May be used for specific antibody production.
Storage : Recombinant Human Klf4-11R is stable for six months at -20centigrade to -80centigrade. Store thawed tube at 4centigrade for seven days. Multiple freeze/thaw cycles may result in significant loss of activity.
Gene Name KLF4 Kruppel-like factor 4 (gut) [ Homo sapiens ]
Official Symbol KLF4
Synonyms KLF4; Kruppel-like factor 4 (gut); Krueppel-like factor 4; EZF; GKLF; gut-enriched krueppel-like factor; epithelial zinc finger protein EZF; endothelial Kruppel-like zinc finger protein;
Gene ID 9314
mRNA Refseq NM_004235
Protein Refseq NP_004226
MIM 602253
UniProt ID O43474
Chromosome Location 9q31
Pathway Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Synthesis, Secretion, and Deacylation of Ghrelin, organism-specific biosystem
Function DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II transcription factor binding; RNA polymerase II transcription fact

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLF4 Products

Required fields are marked with *

My Review for All KLF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon