Active Recombinant Human KLK3 Protein (18-261aa), C-His tagged
Cat.No. : | KLK3-01H |
Product Overview : | Recombinant human Kallikrein 3 protein (18-261aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 18-261 aa |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. |
Form : | Liquid |
Bio-activity : | > 250 pmol/min/μg, and is defined as the amount of enzyme cleaves 1pmole of Succinyl-Arg-Pro-Tyr-p-Nitroanilide to Succinyl-Arg-Pro-Tyr and p-Nitroanilide per minute at pH7.5 at 37 centigrade. |
Molecular Mass : | 27.6 kDa (250 aa) |
AA Sequence : | APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP< HHHHHH> |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Applications : | SDS-PAGE, Enzyme Activity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | KLK3 kallikrein related peptidase 3 [ Homo sapiens (human) ] |
Official Symbol | KLK3 |
Synonyms | KLK3; kallikrein related peptidase 3; APS; PSA; hK3; KLK2A1; prostate-specific antigen; P-30 antigen; gamma-seminoprotein; kallikrein-3; semenogelase; seminin; EC 3.4.21.77 |
Gene ID | 354 |
mRNA Refseq | NM_001648 |
Protein Refseq | NP_001639 |
MIM | 176820 |
UniProt ID | P07288 |
◆ Recombinant Proteins | ||
KLK3-5854HF | Recombinant Full Length Human KLK3 Protein, GST-tagged | +Inquiry |
KLK3-4937H | Recombinant Human KLK3 Protein, GST-tagged | +Inquiry |
KLK3-077H | Recombinant Human KLK3 Protein, His-tagged | +Inquiry |
KLK3-6791H | Recombinant Human Kallikrein-related Peptidase 3, His-tagged | +Inquiry |
KLK3-2846H | Recombinant Human KLK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
KLK3-386H | Native Human Prostate Specific Antigen | +Inquiry |
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK3-1832HCL | Recombinant Human KLK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK3 Products
Required fields are marked with *
My Review for All KLK3 Products
Required fields are marked with *
0
Inquiry Basket