Active Recombinant Human MANF, His-tagged, Biotinylated
Cat.No. : | MANF-639H |
Product Overview : | The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 - Leu179 region of MANF and a C-terminal poly-Histidine tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 22-179 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED50 of 0.7 - 2.8 μg/ml. |
Molecular Mass : | Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation. |
AA Sequence : | LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHH IPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAP KAASARTDLSTGHHHHHHHH |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | MANF mesencephalic astrocyte-derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | MANF |
Synonyms | MANF; mesencephalic astrocyte-derived neurotrophic factor; arginine rich, mutated in early stage tumors , ARMET; ARP; arginine-rich, mutated in early stage tumors; ARMET; MGC142148; MGC142150; |
Gene ID | 7873 |
mRNA Refseq | NM_006010 |
Protein Refseq | NP_006001 |
MIM | 601916 |
UniProt ID | P55145 |
Chromosome Location | 3p21.1 |
Function | growth factor activity; molecular_function; |
◆ Recombinant Proteins | ||
MANF-522H | Recombinant Human MANF Protein, His-tagged | +Inquiry |
MANF-429H | Active Recombinant Human MANF, His-tagged | +Inquiry |
MANF-4636H | Recombinant Human MANF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MANF-4519Z | Recombinant Zebrafish MANF | +Inquiry |
MANF-693H | Recombinant Human MANF protein(Met1-Leu182), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANF-1581MCL | Recombinant Mouse MANF cell lysate | +Inquiry |
MANF-2212HCL | Recombinant Human MANF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MANF Products
Required fields are marked with *
My Review for All MANF Products
Required fields are marked with *