Active Recombinant Human MANF, His-tagged, Biotinylated

Cat.No. : MANF-639H
Product Overview : The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 - Leu179 region of MANF and a C-terminal poly-Histidine tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 22-179 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED50 of 0.7 - 2.8 μg/ml.
Molecular Mass : Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation.
AA Sequence : LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHH IPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAP KAASARTDLSTGHHHHHHHH
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name MANF mesencephalic astrocyte-derived neurotrophic factor [ Homo sapiens ]
Official Symbol MANF
Synonyms MANF; mesencephalic astrocyte-derived neurotrophic factor; arginine rich, mutated in early stage tumors , ARMET; ARP; arginine-rich, mutated in early stage tumors; ARMET; MGC142148; MGC142150;
Gene ID 7873
mRNA Refseq NM_006010
Protein Refseq NP_006001
MIM 601916
UniProt ID P55145
Chromosome Location 3p21.1
Function growth factor activity; molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MANF Products

Required fields are marked with *

My Review for All MANF Products

Required fields are marked with *

0
cart-icon