Active Recombinant Human MAP1S Protein, GST-tagged

Cat.No. : MAP1S-318H
Product Overview : Human BPY2IP1 partial ORF ( NP_060644.4, 929 a.a. - 1026 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Bio-activity : 139 pmol/ug x min
Molecular Mass : 36.52 kDa
AA Sequence : SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MAP1S microtubule-associated protein 1S [ Homo sapiens ]
Official Symbol MAP1S
Synonyms MAP1S; microtubule-associated protein 1S; BPY2 interacting protein 1 , BPY2IP1, C19orf5, chromosome 19 open reading frame 5 , VCY2 interacting protein 1 , VCY2IP1; FLJ10669; MAP8; MAP-1S; BPY2 interacting protein 1; BPY2-interacting protein 1; VCY2 interacting protein 1; VCY2-interacting protein 1; microtubule-associated protein 8; variable charge Y chromosome 2-interacting protein 1; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1; MGC133087;
Gene ID 55201
mRNA Refseq NM_018174
Protein Refseq NP_060644
MIM 607573
UniProt ID Q66K74

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP1S Products

Required fields are marked with *

My Review for All MAP1S Products

Required fields are marked with *

0

Inquiry Basket

cartIcon