Active Recombinant Human MAP1S Protein, GST-tagged
| Cat.No. : | MAP1S-318H |
| Product Overview : | Human BPY2IP1 partial ORF ( NP_060644.4, 929 a.a. - 1026 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Bio-activity : | 139 pmol/ug x min |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MAP1S microtubule-associated protein 1S [ Homo sapiens ] |
| Official Symbol | MAP1S |
| Synonyms | MAP1S; microtubule-associated protein 1S; BPY2 interacting protein 1 , BPY2IP1, C19orf5, chromosome 19 open reading frame 5 , VCY2 interacting protein 1 , VCY2IP1; FLJ10669; MAP8; MAP-1S; BPY2 interacting protein 1; BPY2-interacting protein 1; VCY2 interacting protein 1; VCY2-interacting protein 1; microtubule-associated protein 8; variable charge Y chromosome 2-interacting protein 1; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1; MGC133087; |
| Gene ID | 55201 |
| mRNA Refseq | NM_018174 |
| Protein Refseq | NP_060644 |
| MIM | 607573 |
| UniProt ID | Q66K74 |
| ◆ Recombinant Proteins | ||
| MAP1S-2662R | Recombinant Rhesus monkey MAP1S Protein, His-tagged | +Inquiry |
| MAP1S-2482R | Recombinant Rhesus Macaque MAP1S Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAP1S-2415H | Recombinant Human MAP1S Protein, His-tagged | +Inquiry |
| Map1s-5653M | Recombinant Mouse Map1s protein, His&Myc-tagged | +Inquiry |
| MAP1S-1260H | Recombinant Human MAP1S Protein (794-1053 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP1S-1054HCL | Recombinant Human MAP1S cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP1S Products
Required fields are marked with *
My Review for All MAP1S Products
Required fields are marked with *




