Active Recombinant Human MAP1S Protein, GST-tagged
Cat.No. : | MAP1S-318H |
Product Overview : | Human BPY2IP1 partial ORF ( NP_060644.4, 929 a.a. - 1026 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Bio-activity : | 139 pmol/ug x min |
Molecular Mass : | 36.52 kDa |
AA Sequence : | SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MAP1S microtubule-associated protein 1S [ Homo sapiens ] |
Official Symbol | MAP1S |
Synonyms | MAP1S; microtubule-associated protein 1S; BPY2 interacting protein 1 , BPY2IP1, C19orf5, chromosome 19 open reading frame 5 , VCY2 interacting protein 1 , VCY2IP1; FLJ10669; MAP8; MAP-1S; BPY2 interacting protein 1; BPY2-interacting protein 1; VCY2 interacting protein 1; VCY2-interacting protein 1; microtubule-associated protein 8; variable charge Y chromosome 2-interacting protein 1; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1; MGC133087; |
Gene ID | 55201 |
mRNA Refseq | NM_018174 |
Protein Refseq | NP_060644 |
MIM | 607573 |
UniProt ID | Q66K74 |
◆ Recombinant Proteins | ||
Map1s-5653M | Recombinant Mouse Map1s protein, His&Myc-tagged | +Inquiry |
MAP1S-2415H | Recombinant Human MAP1S Protein, His-tagged | +Inquiry |
MAP1S-732H | Recombinant Human MAP1S, His-tagged | +Inquiry |
MAP1S-2662R | Recombinant Rhesus monkey MAP1S Protein, His-tagged | +Inquiry |
MAP1S-1260H | Recombinant Human MAP1S Protein (794-1053 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP1S-1054HCL | Recombinant Human MAP1S cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP1S Products
Required fields are marked with *
My Review for All MAP1S Products
Required fields are marked with *
0
Inquiry Basket