Active Recombinant Human MMP13 (F175D) Protein

Cat.No. : MMP13-01H
Product Overview : Recombinant Human MMP13 Protein (residues 104-268, F175D mutant) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 104-268
Description : This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.
Bio-activity : > 40 U/μg. Activity described as U=100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 (Biomol) as substrate.
Molecular Mass : 18.6 kDa
AA Sequence : YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDDYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGP
Purity : > 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight of about 18.4 kDa.
Usage : Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors.
Storage : -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade. Avoid repeated freeze/thaw cycles.
Concentration : 0.2 mg/mL
The concentration is calculated by the analysis of the absorbance at 280 nm (ε280 = 29910 M-1cm-1 calculated).
Storage Buffer : Tris 20 mM pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.5 M.
Gene Name MMP13 matrix metallopeptidase 13 [ Homo sapiens (human) ]
Official Symbol MMP13
Synonyms MMP13; matrix metallopeptidase 13; CLG3; MDST; MANDP1; MMP-13; collagenase 3; matrix metalloproteinase 13 (collagenase 3); EC 3.4.24.-
Gene ID 4322
mRNA Refseq NM_002427
Protein Refseq NP_002418
MIM 600108
UniProt ID P45452

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP13 Products

Required fields are marked with *

My Review for All MMP13 Products

Required fields are marked with *

0
cart-icon