Active Recombinant Human MYC protein, arginine-tagged
Cat.No. : | MYC-79H |
Product Overview : | Recombinant human wild-type cMyc cDNA (454 aa) fused with flexible linker domain & eleven arginine (11R Tag) at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.50 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, CaCl2, MgCl2, arginine, DTT, and glycerol. |
Bio-activity : | Cellular Toxicity: This recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium. Suggested reprogramming protein concentration is between 0.5 to 8 ug / ml for both human and mouse fibroblast cells applications.Biolog |
AA Sequence : | MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCAS QDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCAESGGGGSPGRRRRRRRRRRR |
Purity : | >93% by SDS-PAGE |
Applications : | 1. May be used for in vitro human cMyc mediated iPS generation mechanism, or its gene specific transcription regulation study with intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for cMyc protein-protein interaction mapping.4. May be used for specific antibody production. |
Storage : | Recombinant Human c-Myc-11R is stable for six months at -20centigrade to -80centigrade. Store thawed tube at 4centigrade for seven days. Multiple freeze/thaw cycles may result in significant loss of activity. |
Gene Name | MYC v-myc myelocytomatosis viral oncogene homolog (avian) [ Homo sapiens ] |
Official Symbol | MYC |
Synonyms | MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian m |
Gene ID | 4609 |
mRNA Refseq | NM_002467 |
Protein Refseq | NP_002458 |
MIM | 190080 |
UniProt ID | P01106 |
Chromosome Location | 8q24 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem |
Function | DNA binding; DNA binding; E-box binding; protein binding; protein complex binding; repressing transcription factor binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
MYC-26H | Recombinant Human MYC protein, MYC/DDK-tagged | +Inquiry |
Myc-4239M | Recombinant Mouse Myc Protein, Myc/DDK-tagged | +Inquiry |
MYC-2916R | Recombinant Rhesus monkey MYC Protein, His-tagged | +Inquiry |
MYC-1028H | Active Recombinant Human MYC | +Inquiry |
MYC-2641C | Recombinant Chicken MYC | +Inquiry |
◆ Native Proteins | ||
MYC-05H | Recombinant Human MYC Protein, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYC Products
Required fields are marked with *
My Review for All MYC Products
Required fields are marked with *