Active Recombinant Human NANOG protein, Arginine-tagged
| Cat.No. : | NANOG-130H |
| Product Overview : | Recombinant human NANOG protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Bio-activity : | DNA binding activity was demonstrated with ELISA using NANOG specific DNA binding oligo. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPH TETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSL QQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWS NQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGE GLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
| Gene Name | NANOG Nanog homeobox [ Homo sapiens ] |
| Official Symbol | NANOG |
| Synonyms | NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; |
| Gene ID | 79923 |
| mRNA Refseq | NM_024865 |
| Protein Refseq | NP_079141 |
| MIM | 607937 |
| UniProt ID | Q9H9S0 |
| Chromosome Location | 12p13.31 |
| Pathway | Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
| Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| NANOG-5188H | Recombinant Human NANOG Protein (Trp153-Val305), N-His tagged | +Inquiry |
| NANOG-864H | Recombinant Human NANOG | +Inquiry |
| NANOG-3604H | Recombinant Human Nanog | +Inquiry |
| NANOG-159H | Recombinant Human NANOG Protein, 13-residue TAT-tagged | +Inquiry |
| NANOG-5824H | Recombinant Human NANOG protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NANOG-3981HCL | Recombinant Human NANOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NANOG Products
Required fields are marked with *
My Review for All NANOG Products
Required fields are marked with *
