Active Recombinant Human NCR3, Fc-tagged, Biotinylated

Cat.No. : NCR3-643H
Product Overview : The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 - Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 19-135 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to its ligand B7-H6 in a functional ELISA and blocks B7-H6-induced IFN-γ secretion by NK cells.
Molecular Mass : Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~50
AA Sequence : LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAE LHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
Official Symbol NCR3
Synonyms NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID 259197
mRNA Refseq NM_001145466
Protein Refseq NP_001138938
MIM 611550
UniProt ID O14931
Chromosome Location 6p21.3
Pathway Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCR3 Products

Required fields are marked with *

My Review for All NCR3 Products

Required fields are marked with *

0
cart-icon