Active Recombinant Human NCR3, Fc-tagged, Biotinylated
Cat.No. : | NCR3-643H |
Product Overview : | The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 - Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 19-135 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to its ligand B7-H6 in a functional ELISA and blocks B7-H6-induced IFN-γ secretion by NK cells. |
Molecular Mass : | Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~50 |
AA Sequence : | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAE LHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ] |
Official Symbol | NCR3 |
Synonyms | NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117; |
Gene ID | 259197 |
mRNA Refseq | NM_001145466 |
Protein Refseq | NP_001138938 |
MIM | 611550 |
UniProt ID | O14931 |
Chromosome Location | 6p21.3 |
Pathway | Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
NCR3-2961R | Recombinant Rhesus monkey NCR3 Protein, His-tagged | +Inquiry |
NCR3-5087H | Recombinant Human NCR3, His-tagged | +Inquiry |
NCR3-398H | Recombinant Human NCR3 Protein, His-tagged | +Inquiry |
NCR3-151H | Recombinant Human NCR3 Protein, His-tagged | +Inquiry |
NCR3-100H | Recombinant Human NCR3 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCR3 Products
Required fields are marked with *
My Review for All NCR3 Products
Required fields are marked with *
0
Inquiry Basket