Active Recombinant Human NRG4
| Cat.No. : | NRG4-525H |
| Product Overview : | Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells. |
| Form : | Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0. |
| Bio-activity : | The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg. |
| Molecular Mass : | 7 kDa |
| AA Sequence : | HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF |
| Endotoxin : | <0.1 ng/µg (1 EU/µg), using the LAL gel clot method. |
| Purity : | ≥96% by SDS-PAGE and HPLC |
| Stability : | The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20 centigrade. Upon reconstitution, store in working aliquots at +4 centigrade for up to one month, or at -20 centigrade for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles. |
| Reconstitution : | Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid. |
| Gene Name | NRG4 neuregulin 4 [ Homo sapiens ] |
| Official Symbol | NRG4 |
| Synonyms | HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4 |
| Gene ID | 145957 |
| mRNA Refseq | NM_138573 |
| Protein Refseq | NP_612640 |
| MIM | 610894 |
| UniProt ID | Q8WWG1 |
| Chromosome Location | 15q24.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; DAP12 interactions, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem |
| Function | growth factor activity; protein binding; receptor binding |
| ◆ Recombinant Proteins | ||
| Nrg4-02M | Recombinant Mouse neuregulin 4 Protein, His tagged | +Inquiry |
| NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
| NRG4-2472H | Recombinant human NRG4, His-tagged | +Inquiry |
| NRG4-365H | Recombinant Human NRG4 Protein, His/GST-tagged | +Inquiry |
| NRG4-280H | Recombinant Human NRG4 Protein, GST-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
