Active Recombinant Human NRG4

• Cat.No.: NRG4-525H
• Product Overview: Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells.
• Form: Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0.
• Bio-activity: The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg.
• Molecular Mass: 7 kDa
• AA Sequence: HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF
• Endotoxin: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
• Purity: ≥96% by SDS-PAGE and HPLC
• Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20 centigrade. Upon reconstitution, store in working aliquots at +4 centigrade for up to one month, or at -20 centigrade for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
• Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Gene Information

• Gene Name: NRG4 neuregulin 4 [ Homo sapiens ]
• Official Symbol: NRG4
• Synonyms: HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
• Gene ID: 145957
• mRNA Refseq: NM_138573
• Protein Refseq: NP_612640
• MIM: 610894
• UniProt ID: Q8WWG1
• Chromosome Location: 15q24.2
• Pathway: Adaptive Immune System, organism-specific biosystem; DAP12 interactions, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem
• Function: growth factor activity; protein binding; receptor binding