Active Recombinant Human NRG4
Cat.No. : | NRG4-525H |
Product Overview : | Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells. |
Form : | Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0. |
Bio-activity : | The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg. |
Molecular Mass : | 7 kDa |
AA Sequence : | HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF |
Endotoxin : | <0.1 ng/µg (1 EU/µg), using the LAL gel clot method. |
Purity : | ≥96% by SDS-PAGE and HPLC |
Stability : | The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20 centigrade. Upon reconstitution, store in working aliquots at +4 centigrade for up to one month, or at -20 centigrade for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles. |
Reconstitution : | Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid. |
Gene Name | NRG4 neuregulin 4 [ Homo sapiens ] |
Official Symbol | NRG4 |
Synonyms | HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4 |
Gene ID | 145957 |
mRNA Refseq | NM_138573 |
Protein Refseq | NP_612640 |
MIM | 610894 |
UniProt ID | Q8WWG1 |
Chromosome Location | 15q24.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; DAP12 interactions, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem |
Function | growth factor activity; protein binding; receptor binding |
◆ Recombinant Proteins | ||
NRG4-4042H | Recombinant Human NRG4 protein, SUMO&His-tagged | +Inquiry |
NRG4-3043H | Recombinant Human NRG4 protein, His-tagged | +Inquiry |
Nrg4-10M | Recombinant Mouse Nrg4 Protein, Tag Free | +Inquiry |
NRG4-10888M | Recombinant Mouse NRG4 Protein | +Inquiry |
Nrg4-1861R | Recombinant Rat Nrg4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
0
Inquiry Basket