Active Recombinant Human NRG4

Cat.No. : NRG4-525H
Product Overview : Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells.
Form : Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0.
Bio-activity : The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg.
Molecular Mass : 7 kDa
AA Sequence : HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF
Endotoxin : <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Purity : ≥96% by SDS-PAGE and HPLC
Stability : The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20 centigrade. Upon reconstitution, store in working aliquots at +4 centigrade for up to one month, or at -20 centigrade for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Reconstitution : Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Gene Name NRG4 neuregulin 4 [ Homo sapiens ]
Official Symbol NRG4
Synonyms HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
Gene ID 145957
mRNA Refseq NM_138573
Protein Refseq NP_612640
MIM 610894
UniProt ID Q8WWG1
Chromosome Location 15q24.2
Pathway Adaptive Immune System, organism-specific biosystem; DAP12 interactions, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem
Function growth factor activity; protein binding; receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRG4 Products

Required fields are marked with *

My Review for All NRG4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon