| Species : |
Human |
| Source : |
E.coli |
| Description : |
The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation. |
| Form : |
Lyophilized |
| Bio-activity : |
The ED(50) was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3 ng/mL, corresponding to a specific activity of × Units/mg. |
| Molecular Mass : |
Recombinant human Neuregulin-4 EGF domain is a monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. |
| AA Sequence : |
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
| Endotoxin : |
Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg). |
| Purity : |
>96%, as determined by SDS-PAGE and HPLC |
| Usage : |
This cytokine product is for research purposes only. It may not be used for therapeutics or diagnostic purposes. |
| Storage : |
The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this cytokine can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Recombinant Neuregulin-4 was lyophilized from 0.2 μm filtered PB, pH7.0. |
| Reconstitution : |
A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers. |
