Active Recombinant Human NRG4 Protein

Cat.No. : NRG4-07H
Product Overview : Recombinant Human Neuregulin-4 EGF domain was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation.
Form : Lyophilized
Bio-activity : The ED(50) was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3 ng/mL, corresponding to a specific activity of × Units/mg.
Molecular Mass : Recombinant human Neuregulin-4 EGF domain is a monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE.
AA Sequence : MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Endotoxin : Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg).
Purity : >96%, as determined by SDS-PAGE and HPLC
Usage : This cytokine product is for research purposes only. It may not be used for therapeutics or diagnostic purposes.
Storage : The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this cytokine can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
Storage Buffer : Recombinant Neuregulin-4 was lyophilized from 0.2 μm filtered PB, pH7.0.
Reconstitution : A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers.
Gene Name NRG4 neuregulin 4 [ Homo sapiens (human) ]
Official Symbol NRG4
Synonyms NRG4; neuregulin 4; HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
Gene ID 145957
mRNA Refseq NM_138573
Protein Refseq NP_612640
MIM 610894
UniProt ID Q8WWG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRG4 Products

Required fields are marked with *

My Review for All NRG4 Products

Required fields are marked with *

0
cart-icon