Active Recombinant Human PAK7

Cat.No. : PAK7-20H
Product Overview : PAK7KD (PAK5KD) is a recombinant wild type human PAK7 kinase domain (amino acids 425–719 of full-length human PAK7) expressed in E. coli and purified to homogeneity with full activity.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Human PAK7 kinase (UniProt: Q9P286; NCBI: NM_177990) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK7 (PAK5) is predominantly expressed in brain. It is capable of promoting neurite outgrowth and cell survival.
Form : 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bio-activity : 4,199 pmoles/min/μg
Molecular Mass : The calculated mass is 33,934. PAK7KD is fully phosphorylated at S602 and an additional site with a measured mass of 34,096 (2P).
AA Sequence : GPHPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEV VIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLHNQGVIHRDI KSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPY FNEPPLQAIRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYR HH
Applications : Enzymatic studies, inhibitor screen, and selectivity profiling
Storage : Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.
Gene Name PAK7 p21 protein (Cdc42/Rac)-activated kinase 7 [ Homo sapiens ]
Official Symbol PAK7
Synonyms PAK7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A) activated kinase 7; serine/threonine-protein kinase PAK 7; KIAA1264; PAK5; PAK-5; PAK-7; protein kinase PAK5; p21-activated kinase 5; p21-activated kinase 7; p21CDKN1A-activated kinase 7; p21(CDKN1A)-activated kinase 7; serine/threonine-protein kinase PAK7; MGC26232;
Gene ID 57144
mRNA Refseq NM_020341
Protein Refseq NP_065074
MIM 608038
UniProt ID Q9P286
Chromosome Location 20p12
Pathway Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem;
Function ATP binding; nucleotide binding; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAK7 Products

Required fields are marked with *

My Review for All PAK7 Products

Required fields are marked with *

0
cart-icon