Active Recombinant Human PDGFBB Protein (218 aa)
Cat.No. : | PDGFB-153P |
Product Overview : | Recombinant Human PDGFBB Protein (218 aa) without tag was expressed in P. pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | P.pastoris |
Protein Length : | 218 |
Description : | Platelet Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. PDGF which is composed of a dimer of two chains termed the A chain and B chain, can be present as AA or BB homodimers or as an AB heterodimer. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 3 ng/mL, measured by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells, corresponding to a specific activity of > 3.35 units/mg. |
Molecular Mass : | 24.3kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 97% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Platelet-Derived Growth Factor-BB (rhPDGF-BB) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhPDGF-BB should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 10mM acetic acid. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ] |
Official Symbol | PDGFB |
Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog), SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
Gene ID | 5155 |
mRNA Refseq | NM_002608 |
Protein Refseq | NP_002599 |
MIM | 190040 |
UniProt ID | P01127 |
◆ Recombinant Proteins | ||
PDGFB-58H | Recombinant Human PDGFB, His-tagged | +Inquiry |
Pdgfb-173R | Recombinant Rat Pdgfb protein, His/S-tagged | +Inquiry |
PDGFB-524H | Active Recombinant Human PDGFB | +Inquiry |
PDGFB-224H | Active Recombinant Human PDGFB Protein | +Inquiry |
PDGFB-2571H | Recombinant Human PDGFB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *