Active Recombinant Human PDGFBB Protein (218 aa)

Cat.No. : PDGFB-153P
Product Overview : Recombinant Human PDGFBB Protein (218 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : P.pastoris
Protein Length : 218
Description : Platelet Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. PDGF which is composed of a dimer of two chains termed the A chain and B chain, can be present as AA or BB homodimers or as an AB heterodimer.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 3 ng/mL, measured by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells, corresponding to a specific activity of > 3.35 units/mg.
Molecular Mass : 24.3kDa, observed by non-reducing SDS-PAGE.
AA Sequence : SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 97% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Platelet-Derived Growth Factor-BB (rhPDGF-BB) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhPDGF-BB should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 10mM acetic acid.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ]
Official Symbol PDGFB
Synonyms PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog), SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858;
Gene ID 5155
mRNA Refseq NM_002608
Protein Refseq NP_002599
MIM 190040
UniProt ID P01127

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFB Products

Required fields are marked with *

My Review for All PDGFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon