Recombinant Human PDGFB protein, His-SUMO-tagged
| Cat.No. : | PDGFB-3325H |
| Product Overview : | Recombinant Human PDGFB protein(P01127)(82-190aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 82-190aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.3 |
| AA Sequence : | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ] |
| Official Symbol | PDGFB |
| Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
| Gene ID | 5155 |
| mRNA Refseq | NM_002608 |
| Protein Refseq | NP_002599 |
| MIM | 190040 |
| UniProt ID | P01127 |
| ◆ Recombinant Proteins | ||
| Pdgfb-1931R | Recombinant Rat Pdgfb Protein, His&GST-tagged | +Inquiry |
| PDGFB-146H | Active Recombinant Human PDGFB | +Inquiry |
| Pdgfb-639R | Recombinant Rat Pdgfb protein, His & GST-tagged | +Inquiry |
| Pdgfb-55M | Recombinant Mouse Pdgfb protein | +Inquiry |
| PDGFB-312H | Active Recombinant Human PDGFB protein, Animal-Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *
