Active Recombinant Human PDGFRA, Fc-tagged, Biotinylated
Cat.No. : | PDGFRA-662H |
Product Overview : | The recombinant human PDGFRA-Fc fusion is expressed as a 733 amino acid protein consisting of Gln24 - Ala528 region of PDGFRA and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 24-528 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds human PDGF family members (PDGFA, PDGFB and PDGFC) and blocks PDGF-mediated signaling activity in fibroblast cells. |
Molecular Mass : | Calculated molecular mass (kDa): 82.1; Estimated by SDS-PAGE under reducing condition (kDa): 90-100 |
AA Sequence : | QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGL YTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPAS YDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDL QWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIK PTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHY TIVAQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILA NNVSNIITEIHPRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVASTGTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | PDGFRA platelet-derived growth factor receptor, alpha polypeptide [ Homo sapiens ] |
Official Symbol | PDGFRA |
Synonyms | PDGFRA; platelet-derived growth factor receptor, alpha polypeptide; platelet-derived growth factor receptor alpha; CD140a; PDGFR2; PDGFR-alpha; PDGF-R-alpha; CD140a antigen; PDGFRA/BCR fusion; CD140 antigen-like family member A; platelet-derived growth factor receptor 2; alpha-type platelet-derived growth factor receptor; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; CD140A; PDGFR-2; RHEPDGFRA; MGC74795; |
Gene ID | 5156 |
mRNA Refseq | NM_006206 |
Protein Refseq | NP_006197 |
MIM | 173490 |
UniProt ID | P16234 |
Chromosome Location | 4q12 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signal transduction, organism-specific biosystem; Endocytosis, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; phosphatidylinositol 3-kinase binding; platelet-derived growth factor alpha-receptor activity; platelet-derived growth factor alpha-receptor activity; platelet-derived growth factor binding; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor binding; vascular endothelial growth factor-activated receptor activity; |
◆ Recombinant Proteins | ||
Pdgfra-52RF | Recombinant Rat Pdgfra Protein, His-tagged, FITC conjugated | +Inquiry |
PDGFRA-2884H | Recombinant Human PDGFRA protein, His-tagged | +Inquiry |
Pdgfra-52RAF488 | Recombinant Rat Pdgfra Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PDGFRA-6767M | Recombinant Mouse PDGFRA Protein (Leu25-Glu524), C-His tagged | +Inquiry |
PDGFRA-38H | Recombinant Active Human PDGFR alpha (E675G Y676C) Mutant Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRA-824RCL | Recombinant Rat PDGFRA cell lysate | +Inquiry |
PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
PDGFRA-001HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFRA Products
Required fields are marked with *
My Review for All PDGFRA Products
Required fields are marked with *