Active Recombinant Human PPBP Protein (70 aa)
Cat.No. : | PPBP-215P |
Product Overview : | Recombinant human NAP-2/CXCL7 produced in CHO cells is a single polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhNAP-2/CXCL7 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 70 |
Description : | Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human NAP-2/CXCL7 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCXCR1 cells (human Ga15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 0.1 μg/mL. |
Molecular Mass : | 9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant humanNAP-2/CXCL7 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human NAP-2/CXCL7 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | PPBP pro-platelet basic protein [ Homo sapiens (human) ] |
Official Symbol | PPBP |
Synonyms | PPBP; pro-platelet basic protein; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; platelet basic protein; C-X-C motif chemokine 7; CXC chemokine ligand 7; beta-thromboglobulin; chemokine (C-X-C motif) ligand 7; connective tissue-activating peptide III; leukocyte-derived growth factor; low-affinity platelet factor IV; macrophage-derived growth factor; neutrophil-activating peptide 2; small inducible cytokine B7; small inducible cytokine subfamily B, member 7; thrombocidin 1; thrombocidin 2; thromboglobulin, beta-1; |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
UniProt ID | P02775 |
◆ Recombinant Proteins | ||
PPBP-04H PPBP | Recombinant Human PPBP protein | +Inquiry |
PPBP-3084H | Recombinant Human PPBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPBP-5943H | Recombinant Human PPBP Protein (Ala59-Asp128), His tagged | +Inquiry |
Ppbp-325P | Active Recombinant Rat Ppbp Protein (62 aa) | +Inquiry |
PPBP-04H | Recombinant Human chemokine (C-X-C Motif) Ligand 7 | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
0
Inquiry Basket