Recombinant Human PPBP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPBP-3084H |
Product Overview : | PPBP MS Standard C13 and N15-labeled recombinant protein (NP_002695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESADTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPBP pro-platelet basic protein [ Homo sapiens (human) ] |
Official Symbol | PPBP |
Synonyms | PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III; |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
UniProt ID | P02775 |
◆ Recombinant Proteins | ||
Ppbp-260M | Active Recombinant Mouse Ppbp Protein (Ile48-Ile109), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Ppbp-846M | Recombinant Mouse Ppbp Protein, His-tagged | +Inquiry |
PPBP-29720TH | Recombinant Full Length Human PPBP Protein | +Inquiry |
PPBP-04H PPBP | Recombinant Human PPBP protein | +Inquiry |
PPBP-519P | Recombinant Pig PPBP Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *