Active Recombinant Human RSPO2 Protein
| Cat.No. : | RSPO2-171H |
| Product Overview : | Recombinant Human RSPO2 was expressed in CHO cells. |
| Availability | November 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Description : | This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
| Bio-activity : | R-Spondin-2 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. |
| Molecular Mass : | 24.4 kDa |
| AA Sequence : | ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Resuspend the protein in the desired concentration in proper buffer |
| Gene Name | RSPO2 R-spondin 2 [ Homo sapiens ] |
| Official Symbol | RSPO2 |
| Synonyms | RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342; |
| Gene ID | 340419 |
| mRNA Refseq | NM_178565 |
| Protein Refseq | NP_848660 |
| MIM | 610575 |
| UniProt ID | Q6UXX9 |
| ◆ Recombinant Proteins | ||
| RSPO2-7833M | Recombinant Mouse RSPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RSPO2-866H | Active Recombinant Human RSPO2 Protein, His-tagged | +Inquiry |
| RSPO2-42HCL | Recombinant Human RSPO2 HEK293T cell lysate | +Inquiry |
| RSPO2-4013H | Recombinant Human RSPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rspo2-850M | Active Recombinant Mouse Rspo2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RSPO2-1645HCL | Recombinant Human RSPO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO2 Products
Required fields are marked with *
My Review for All RSPO2 Products
Required fields are marked with *
