Active Recombinant Human SELE Protein, His-tagged
Cat.No. : | SELE-05H |
Product Overview : | Recombinant human E selectin (22-556aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 22-556 a.a. |
Description : | The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. |
Form : | Liquid |
Bio-activity : | Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When cells are added to human E-Seletin/CD62E coated plates 2 μg/mL. This effect is more to 40%. |
Molecular Mass : | 59.4kDa(541aa) |
AA Sequence : | WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | SELE selectin E [ Homo sapiens (human) ] |
Official Symbol | SELE |
Synonyms | SELE; selectin E; ELAM; ESEL; CD62E; ELAM1; LECAM2; E-selectin; CD62 antigen-like family member E; ELAM-1; endothelial adhesion molecule 1; endothelial leukocyte adhesion molecule 1; leukocyte endothelial cell adhesion molecule 2 |
Gene ID | 6401 |
mRNA Refseq | NM_000450 |
Protein Refseq | NP_000441 |
MIM | 131210 |
UniProt ID | P16581 |
◆ Recombinant Proteins | ||
Sele-4093R | Active Recombinant Rat Sele protein(Met1-Pro494), His-tagged | +Inquiry |
Sele-6390R | Recombinant Rat Sele Protein, His (Fc)-Avi-tagged | +Inquiry |
SELE-94C | Recombinant Cynomolgus SELE, His tagged | +Inquiry |
RFL35126HF | Recombinant Full Length Human E-Selectin(Sele) Protein, His-Tagged | +Inquiry |
SELE-608H | Recombinant Human SELE protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
SELE-960RCL | Recombinant Rat SELE cell lysate | +Inquiry |
SELE-1099CCL | Recombinant Cynomolgus SELE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELE Products
Required fields are marked with *
My Review for All SELE Products
Required fields are marked with *
0
Inquiry Basket