Active Recombinant Human SGK1 protein, His-tagged
| Cat.No. : | SGK1-3920H |
| Product Overview : | Recombinant Human SGK1 fused with His tag at the N-terminus was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Form : | 50 mM Tris/HCl pH7.5, 0.1 mM EGTA, 150 mM NaCl, 0.1% ßMercaptoethanol, 270 mM sucrose, 0.03% Brij-35, 1 mM Benzamidine, 0.2 mM PMSF |
| Bio-activity : | 1088 Units/mg (750.8 Units/ml) |
| Molecular Mass : | ~45.5 kDa |
| AA Sequence : | MSYYHHHHHH DYDIPTT E N LYFQGAMGISQPQEPELMNANPSPPPSPSQQ INLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIM SERNVLLKNVKHPFLVGLHFSFQTADKLYFV LDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIV LTDFGLCKENIEHNSTTSTFCGTPEYLAPE VLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHL LEGLLQKDRTKRLGAKDDFMEIKSHVFFSLIN WDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFL GFDYAPPTDSFL |
| Purity : | >90% by InstantBlue™ SDS-PAGE |
| Unit Definition : | 1 Unit = 1 nmole of phosphate incorporated into the substrate in 1 minute. |
| Stability : | 12 months at -70 centigrade; aliquot as required. |
| Storage : | Store at -70 centigrade |
| Concentration : | 0.69 mg/ml |
| Gene Name | SGK1 serum/glucocorticoid regulated kinase 1 [ Homo sapiens ] |
| Official Symbol | SGK1 |
| Synonyms | SGK1; serum/glucocorticoid regulated kinase 1; serum/glucocorticoid regulated kinase , SGK; serine/threonine-protein kinase Sgk1; serine/threonine protein kinase SGK; serum/glucocorticoid-regulated kinase 1; SGK; |
| Gene ID | 6446 |
| mRNA Refseq | NM_005627 |
| Protein Refseq | NP_005618 |
| MIM | 602958 |
| UniProt ID | O00141 |
| Chromosome Location | 6q23 |
| Pathway | Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Class I PI3K signaling events, organism-specific biosystem; FoxO family signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Insulin Pathway, organism-specific biosystem; |
| Function | ATP binding; calcium channel regulator activity; chloride channel regulator activity; nucleotide binding; potassium channel regulator activity; protein serine/threonine kinase activity; sodium channel regulator activity; |
| ◆ Recombinant Proteins | ||
| SGK1-2811H | Recombinant Human SGK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SGK1-1185H | Recombinant Human SGK1 Protein (S61-L431), His/GST tagged | +Inquiry |
| SGK1-1184H | Recombinant Human SGK1 Protein (S61-L431), Tag Free | +Inquiry |
| SGK1-30970TH | Recombinant Human SGK1 | +Inquiry |
| Sgk1-145M | Recombinant Mouse Sgk1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGK1 Products
Required fields are marked with *
My Review for All SGK1 Products
Required fields are marked with *
