Active Recombinant Human SIGLEC9, Fc-tagged, Biotinylated
Cat.No. : | SIGLEC9-676H |
Product Overview : | The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 - Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 18-348 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized protein supports the adhesion of human red blood cells. Blocks CD329-binding to its ligand and signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 61.4; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 (probably due to glycosylation) |
AA Sequence : | QTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDAPVATNNPARAVWEETRDRF HLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCS VPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQN LTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHL RDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SIGLEC9 sialic acid binding Ig-like lectin 9 [ Homo sapiens ] |
Official Symbol | SIGLEC9 |
Synonyms | SIGLEC9; sialic acid binding Ig-like lectin 9; sialic acid-binding Ig-like lectin 9; CD329; protein FOAP-9; CDw329; FOAP-9; siglec-9; OBBP-LIKE; |
Gene ID | 27180 |
mRNA Refseq | NM_001198558 |
Protein Refseq | NP_001185487 |
MIM | 605640 |
UniProt ID | Q9Y336 |
Chromosome Location | 19q13.3-q13.4 |
Function | sugar binding; |
◆ Recombinant Proteins | ||
SIGLEC9-0734H | Active Recombinant Human SIGLEC9 protein, Fc-tagged | +Inquiry |
SIGLEC9-0735H | Active Recombinant Human SIGLEC9 protein, His-tagged | +Inquiry |
SIGLEC9-963HFL | Recombinant Full Length Human SIGLEC9 Protein, C-Flag-tagged | +Inquiry |
SIGLEC9-0732H | Recombinant Human SIGLEC9 protein, His-Avi-tagged, Biotinylated | +Inquiry |
SIGLEC9-677H | Recombinant Human SIGLEC9 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
SIGLEC9-57H | Active Recombinant Human SIGLEC9 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC9-1844HCL | Recombinant Human SIGLEC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLEC9 Products
Required fields are marked with *
My Review for All SIGLEC9 Products
Required fields are marked with *